BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0579 (490 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g57870.1 68416.m06451 ubiquitin-conjugating enzyme, putative ... 102 1e-22 At2g02760.1 68415.m00219 ubiquitin-conjugating enzyme 2 (UBC2) E... 64 4e-11 At1g14400.2 68414.m01708 ubiquitin-conjugating enzyme 1 (UBC1) E... 64 4e-11 At1g14400.1 68414.m01707 ubiquitin-conjugating enzyme 1 (UBC1) E... 64 4e-11 At1g36340.1 68414.m04516 ubiquitin-conjugating enzyme family pro... 64 5e-11 At5g62540.1 68418.m07849 ubiquitin-conjugating enzyme 3 (UBC3) E... 63 8e-11 At3g13550.1 68416.m01703 ubiquitin-conjugating enzyme (COP10) id... 57 7e-09 At5g59300.1 68418.m07430 ubiquitin-conjugating enzyme 7 (UBC7) E... 56 2e-08 At3g46460.1 68416.m05037 ubiquitin-conjugating enzyme 13 (UBC13)... 56 2e-08 At1g64230.1 68414.m07276 ubiquitin-conjugating enzyme, putative ... 55 3e-08 At4g27960.2 68417.m04012 ubiquitin-conjugating enzyme E2-17 kDa ... 54 4e-08 At4g27960.1 68417.m04011 ubiquitin-conjugating enzyme E2-17 kDa ... 54 4e-08 At3g08690.1 68416.m01010 ubiquitin-conjugating enzyme 11 (UBC11)... 54 5e-08 At1g50490.1 68414.m05662 ubiquitin-conjugating enzyme 20 (UBC20)... 54 5e-08 At5g53300.2 68418.m06625 ubiquitin-conjugating enzyme 10 (UBC10)... 54 7e-08 At5g53300.1 68418.m06624 ubiquitin-conjugating enzyme 10 (UBC10)... 54 7e-08 At5g41700.4 68418.m05071 ubiquitin-conjugating enzyme 8 (UBC8) E... 54 7e-08 At5g41700.2 68418.m05070 ubiquitin-conjugating enzyme 8 (UBC8) E... 54 7e-08 At5g41700.1 68418.m05069 ubiquitin-conjugating enzyme 8 (UBC8) E... 54 7e-08 At2g16740.1 68415.m01920 ubiquitin-conjugating enzyme, putative ... 54 7e-08 At5g56150.2 68418.m07005 ubiquitin-conjugating enzyme, putative ... 53 9e-08 At5g56150.1 68418.m07004 ubiquitin-conjugating enzyme, putative ... 53 9e-08 At5g50870.1 68418.m06304 ubiquitin-conjugating enzyme, putative ... 53 9e-08 At5g41700.3 68418.m05068 ubiquitin-conjugating enzyme 8 (UBC8) E... 52 2e-07 At3g55380.1 68416.m06151 ubiquitin-conjugating enzyme 14 (UBC14)... 52 2e-07 At3g08700.1 68416.m01011 ubiquitin-conjugating enzyme, putative ... 51 4e-07 At3g20060.1 68416.m02537 ubiquitin-conjugating enzyme 19 (UBC19)... 51 5e-07 At5g05080.1 68418.m00539 ubiquitin-conjugating enzyme, putative ... 50 6e-07 At5g25760.1 68418.m03057 ubiquitin-conjugating enzyme, putative ... 48 3e-06 At1g78870.2 68414.m09194 ubiquitin-conjugating enzyme, putative ... 48 4e-06 At1g78870.1 68414.m09193 ubiquitin-conjugating enzyme, putative ... 48 4e-06 At1g16890.2 68414.m02044 ubiquitin-conjugating enzyme, putative ... 48 4e-06 At1g16890.1 68414.m02043 ubiquitin-conjugating enzyme, putative ... 46 1e-05 At2g32790.1 68415.m04014 ubiquitin-conjugating enzyme, putative ... 44 4e-05 At3g15355.1 68416.m01945 ubiquitin-conjugating enzyme-related si... 40 9e-04 At1g53020.1 68414.m06002 ubiquitin-conjugating enzyme family pro... 38 0.003 At2g16920.1 68415.m01949 ubiquitin-conjugating enzyme family pro... 35 0.026 At2g33770.1 68415.m04141 ubiquitin-conjugating enzyme family pro... 35 0.034 At1g63800.1 68414.m07220 ubiquitin-conjugating enzyme 5 (UBC5) E... 34 0.059 At1g70660.1 68414.m08146 ubiquitin-conjugating enzyme family pro... 33 0.10 At5g41340.1 68418.m05024 ubiquitin-conjugating enzyme 4 (UBC4) E... 33 0.14 At1g23260.1 68414.m02910 ubiquitin-conjugating enzyme family pro... 32 0.18 At5g50430.1 68418.m06245 ubiquitin-conjugating enzyme, putative ... 32 0.24 At3g17000.1 68416.m02171 ubiquitin-conjugating enzyme, putative ... 32 0.24 At1g17280.1 68414.m02105 ubiquitin-conjugating enzyme, putative ... 32 0.24 At3g52560.1 68416.m05784 ubiquitin-conjugating enzyme family pro... 29 1.7 At2g36060.1 68415.m04427 ubiquitin-conjugating enzyme family pro... 29 1.7 At4g13680.1 68417.m02126 hypothetical protein contains Pfam prof... 27 5.1 At2g46030.1 68415.m05726 ubiquitin-conjugating enzyme 6 (UBC6) E... 27 5.1 >At3g57870.1 68416.m06451 ubiquitin-conjugating enzyme, putative strong similarity to SP|P50550 Ubiquitin-like protein SUMO-1 conjugating enzyme (EC 6.3.2.19) (SUMO- 1-protein ligase) (Ubiquitin carrier protein) (Ubiquitin-conjugating enzyme UbcE2A) {Xenopus laevis}; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 160 Score = 102 bits (245), Expect = 1e-22 Identities = 47/79 (59%), Positives = 53/79 (67%) Frame = +1 Query: 253 MNLMTWECAIPGKKGTPWEGGLYKLRMIFKDDXPSSPXKCKFEPPLXHPNVYPSGTVXLS 432 +NLM W C IPGK GT WEGG + L M F +D PS P KCKF HPNVYPSGTV LS Sbjct: 37 VNLMVWHCTIPGKAGTDWEGGFFPLTMHFSEDYPSKPPKCKFPQGFFHPNVYPSGTVCLS 96 Query: 433 LL*LKKXXGXPAITIKQIL 489 +L + PAIT+KQIL Sbjct: 97 IL-NEDYGWRPAITVKQIL 114 Score = 54.4 bits (125), Expect = 4e-08 Identities = 23/34 (67%), Positives = 27/34 (79%) Frame = +2 Query: 152 SGIASARLAEERKAWRKDHPFGFVARPMKNPDGS 253 SGIA RLAEERK+WRK+HP GFVA+P DG+ Sbjct: 3 SGIARGRLAEERKSWRKNHPHGFVAKPETGQDGT 36 >At2g02760.1 68415.m00219 ubiquitin-conjugating enzyme 2 (UBC2) E2; identical to gi:2689242, SP:P42745 Length = 152 Score = 64.5 bits (150), Expect = 4e-11 Identities = 24/61 (39%), Positives = 36/61 (59%) Frame = +1 Query: 256 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDXPSSPXKCKFEPPLXHPNVYPSGTVXLSL 435 N+M W I G TPW+GG +KL + F +D P+ P +F + HPN+Y G++ L + Sbjct: 32 NIMLWNAVIFGPDDTPWDGGTFKLSLQFSEDYPNKPPTVRFVSRMFHPNIYADGSICLDI 91 Query: 436 L 438 L Sbjct: 92 L 92 >At1g14400.2 68414.m01708 ubiquitin-conjugating enzyme 1 (UBC1) E2; identical to gi:431259, SP:P25865 Length = 152 Score = 64.5 bits (150), Expect = 4e-11 Identities = 24/61 (39%), Positives = 36/61 (59%) Frame = +1 Query: 256 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDXPSSPXKCKFEPPLXHPNVYPSGTVXLSL 435 N+M W I G TPW+GG +KL + F +D P+ P +F + HPN+Y G++ L + Sbjct: 32 NIMLWNAVIFGPDDTPWDGGTFKLSLQFSEDYPNKPPTVRFVSRMFHPNIYADGSICLDI 91 Query: 436 L 438 L Sbjct: 92 L 92 >At1g14400.1 68414.m01707 ubiquitin-conjugating enzyme 1 (UBC1) E2; identical to gi:431259, SP:P25865 Length = 152 Score = 64.5 bits (150), Expect = 4e-11 Identities = 24/61 (39%), Positives = 36/61 (59%) Frame = +1 Query: 256 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDXPSSPXKCKFEPPLXHPNVYPSGTVXLSL 435 N+M W I G TPW+GG +KL + F +D P+ P +F + HPN+Y G++ L + Sbjct: 32 NIMLWNAVIFGPDDTPWDGGTFKLSLQFSEDYPNKPPTVRFVSRMFHPNIYADGSICLDI 91 Query: 436 L 438 L Sbjct: 92 L 92 >At1g36340.1 68414.m04516 ubiquitin-conjugating enzyme family protein similar to Ubiquitin-conjugating enzyme E2-16 kDa (EC 6.3.2.19) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) from {Schizosaccharomyces pombe} SP|P46595, {Caenorhabditis elegans} SP|P35129; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 154 Score = 64.1 bits (149), Expect = 5e-11 Identities = 27/78 (34%), Positives = 45/78 (57%) Frame = +1 Query: 256 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDXPSSPXKCKFEPPLXHPNVYPSGTVXLSL 435 N+ W I G GTP+EGG++ L + F D P P K F+ P+ HPN+ G++ +++ Sbjct: 35 NIYEWTAVIRGPDGTPYEGGMFNLSIKFPTDYPFKPPKFTFKTPIYHPNINDEGSICMNI 94 Query: 436 L*LKKXXGXPAITIKQIL 489 L K PA+ ++++L Sbjct: 95 L---KDKWTPALMVEKVL 109 >At5g62540.1 68418.m07849 ubiquitin-conjugating enzyme 3 (UBC3) E2; identical to gi:431261, SP:P42746 Length = 150 Score = 63.3 bits (147), Expect = 8e-11 Identities = 24/61 (39%), Positives = 37/61 (60%) Frame = +1 Query: 256 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDXPSSPXKCKFEPPLXHPNVYPSGTVXLSL 435 N+M W I G + TPW+GG +KL + F +D P+ P +F + HPN+Y G++ L + Sbjct: 32 NIMHWNALIFGPEDTPWDGGTFKLTLHFTEDYPNKPPIVRFVSRMFHPNIYADGSICLDI 91 Query: 436 L 438 L Sbjct: 92 L 92 >At3g13550.1 68416.m01703 ubiquitin-conjugating enzyme (COP10) identical to ubiquitin-conjugating enzyme COP10 [Arabidopsis thaliana] GI:20065779; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 182 Score = 56.8 bits (131), Expect = 7e-09 Identities = 29/78 (37%), Positives = 44/78 (56%) Frame = +1 Query: 256 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDXPSSPXKCKFEPPLXHPNVYPSGTVXLSL 435 NL W I G GTP+EGG++ L +IF D P P K F+ + H NV +G + +++ Sbjct: 64 NLYHWIATIIGPSGTPYEGGIFFLDIIFPSDYPFKPPKLVFKTRIYHCNVDTAGDLSVNI 123 Query: 436 L*LKKXXGXPAITIKQIL 489 L + PA+TI ++L Sbjct: 124 L---RDSWSPALTITKVL 138 >At5g59300.1 68418.m07430 ubiquitin-conjugating enzyme 7 (UBC7) E2; identical to gi:992703, SP:P42747 Length = 198 Score = 55.6 bits (128), Expect = 2e-08 Identities = 32/92 (34%), Positives = 42/92 (45%) Frame = +1 Query: 163 KCTFS*RTESLA*GPSLWFCREAYEESRWFMNLMTWECAIPGKKGTPWEGGLYKLRMIFK 342 K FS R S A S W +S N+ W I G T +EGG + M F Sbjct: 37 KLAFSFRNNSKA---SPWNLSPYQNQSCDCYNIFEWSVTIIGPPDTLYEGGFFNAIMTFP 93 Query: 343 DDXPSSPXKCKFEPPLXHPNVYPSGTVXLSLL 438 + P+SP +F + HPNVY G V +S+L Sbjct: 94 QNYPNSPPTVRFTSDMWHPNVYSDGRVCISIL 125 >At3g46460.1 68416.m05037 ubiquitin-conjugating enzyme 13 (UBC13) E2; identical to gi:992706 Length = 166 Score = 55.6 bits (128), Expect = 2e-08 Identities = 24/61 (39%), Positives = 33/61 (54%) Frame = +1 Query: 256 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDXPSSPXKCKFEPPLXHPNVYPSGTVXLSL 435 N+ W I G T +EGG + M F + P+SP +F + HPNVYP G V +S+ Sbjct: 33 NIFEWSVTIIGPPDTLYEGGFFYAIMSFPQNYPNSPPTVRFTSDIWHPNVYPDGRVCISI 92 Query: 436 L 438 L Sbjct: 93 L 93 >At1g64230.1 68414.m07276 ubiquitin-conjugating enzyme, putative identical or nearly so to Ubiquitin-conjugating enzymes SP|P35132, SP|P35131, SP|P35133 from {Arabidopsis thaliana}; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 148 Score = 54.8 bits (126), Expect = 3e-08 Identities = 25/78 (32%), Positives = 42/78 (53%) Frame = +1 Query: 256 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDXPSSPXKCKFEPPLXHPNVYPSGTVXLSL 435 ++ W+ I G +P+ GG++ + + F D P P K F + HPNV +G++ L + Sbjct: 29 DMFHWQATIMGPSDSPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNVNSNGSICLDI 88 Query: 436 L*LKKXXGXPAITIKQIL 489 L K PA+TI ++L Sbjct: 89 L---KEQWSPALTISKVL 103 >At4g27960.2 68417.m04012 ubiquitin-conjugating enzyme E2-17 kDa 9 (UBC9) E2; identical to gi:297883, SP:P35132; identical to cDNA UBC9 for ubiquitin conjugating enzyme homolog GI:297883 Length = 178 Score = 54.4 bits (125), Expect = 4e-08 Identities = 24/78 (30%), Positives = 42/78 (53%) Frame = +1 Query: 256 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDXPSSPXKCKFEPPLXHPNVYPSGTVXLSL 435 ++ W+ I G +P+ GG++ + + F D P P K F + HPN+ +G++ L + Sbjct: 59 DMFHWQATIMGPSDSPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDI 118 Query: 436 L*LKKXXGXPAITIKQIL 489 L K PA+TI ++L Sbjct: 119 L---KEQWSPALTISKVL 133 >At4g27960.1 68417.m04011 ubiquitin-conjugating enzyme E2-17 kDa 9 (UBC9) E2; identical to gi:297883, SP:P35132; identical to cDNA UBC9 for ubiquitin conjugating enzyme homolog GI:297883 Length = 148 Score = 54.4 bits (125), Expect = 4e-08 Identities = 24/78 (30%), Positives = 42/78 (53%) Frame = +1 Query: 256 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDXPSSPXKCKFEPPLXHPNVYPSGTVXLSL 435 ++ W+ I G +P+ GG++ + + F D P P K F + HPN+ +G++ L + Sbjct: 29 DMFHWQATIMGPSDSPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDI 88 Query: 436 L*LKKXXGXPAITIKQIL 489 L K PA+TI ++L Sbjct: 89 L---KEQWSPALTISKVL 103 >At3g08690.1 68416.m01010 ubiquitin-conjugating enzyme 11 (UBC11) E2; identical to gi:12643427, SP:P35134 Length = 148 Score = 54.0 bits (124), Expect = 5e-08 Identities = 24/78 (30%), Positives = 43/78 (55%) Frame = +1 Query: 256 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDXPSSPXKCKFEPPLXHPNVYPSGTVXLSL 435 ++ W+ I G +P+ GG++ + + F D P P K F+ + HPN+ +G++ L + Sbjct: 29 DMFHWQATIMGPPESPYAGGVFLVSIHFPPDYPFKPPKVSFKTKVYHPNINSNGSICLDI 88 Query: 436 L*LKKXXGXPAITIKQIL 489 L K PA+TI ++L Sbjct: 89 L---KEQWSPALTISKVL 103 >At1g50490.1 68414.m05662 ubiquitin-conjugating enzyme 20 (UBC20) nearly identical to ubiquitin-conjugating enzyme UBC20 [Arabidopsis thaliana] GI:22530867; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 180 Score = 54.0 bits (124), Expect = 5e-08 Identities = 25/61 (40%), Positives = 33/61 (54%) Frame = +1 Query: 256 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDXPSSPXKCKFEPPLXHPNVYPSGTVXLSL 435 N+ W+ I G K T +EG Y+L + F +D P P K KFE HPNV G + L + Sbjct: 63 NIFCWKGTITGSKDTVFEGTEYRLSLSFSNDYPFKPPKVKFETCCFHPNVDVYGNICLDI 122 Query: 436 L 438 L Sbjct: 123 L 123 >At5g53300.2 68418.m06625 ubiquitin-conjugating enzyme 10 (UBC10) E2; identical to gi:297877, SP:P35133 Length = 148 Score = 53.6 bits (123), Expect = 7e-08 Identities = 24/78 (30%), Positives = 42/78 (53%) Frame = +1 Query: 256 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDXPSSPXKCKFEPPLXHPNVYPSGTVXLSL 435 ++ W+ I G +P+ GG++ + + F D P P K F + HPN+ +G++ L + Sbjct: 29 DMFHWQATIMGPSESPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDI 88 Query: 436 L*LKKXXGXPAITIKQIL 489 L K PA+TI ++L Sbjct: 89 L---KEQWSPALTISKVL 103 >At5g53300.1 68418.m06624 ubiquitin-conjugating enzyme 10 (UBC10) E2; identical to gi:297877, SP:P35133 Length = 148 Score = 53.6 bits (123), Expect = 7e-08 Identities = 24/78 (30%), Positives = 42/78 (53%) Frame = +1 Query: 256 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDXPSSPXKCKFEPPLXHPNVYPSGTVXLSL 435 ++ W+ I G +P+ GG++ + + F D P P K F + HPN+ +G++ L + Sbjct: 29 DMFHWQATIMGPSESPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDI 88 Query: 436 L*LKKXXGXPAITIKQIL 489 L K PA+TI ++L Sbjct: 89 L---KEQWSPALTISKVL 103 >At5g41700.4 68418.m05071 ubiquitin-conjugating enzyme 8 (UBC8) E2; identical to gi:297882, SP:P35131 Length = 149 Score = 53.6 bits (123), Expect = 7e-08 Identities = 24/78 (30%), Positives = 42/78 (53%) Frame = +1 Query: 256 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDXPSSPXKCKFEPPLXHPNVYPSGTVXLSL 435 ++ W+ I G +P+ GG++ + + F D P P K F + HPN+ +G++ L + Sbjct: 30 DMFHWQATIMGPAESPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDI 89 Query: 436 L*LKKXXGXPAITIKQIL 489 L K PA+TI ++L Sbjct: 90 L---KEQWSPALTISKVL 104 >At5g41700.2 68418.m05070 ubiquitin-conjugating enzyme 8 (UBC8) E2; identical to gi:297882, SP:P35131 Length = 148 Score = 53.6 bits (123), Expect = 7e-08 Identities = 24/78 (30%), Positives = 42/78 (53%) Frame = +1 Query: 256 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDXPSSPXKCKFEPPLXHPNVYPSGTVXLSL 435 ++ W+ I G +P+ GG++ + + F D P P K F + HPN+ +G++ L + Sbjct: 29 DMFHWQATIMGPAESPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDI 88 Query: 436 L*LKKXXGXPAITIKQIL 489 L K PA+TI ++L Sbjct: 89 L---KEQWSPALTISKVL 103 >At5g41700.1 68418.m05069 ubiquitin-conjugating enzyme 8 (UBC8) E2; identical to gi:297882, SP:P35131 Length = 148 Score = 53.6 bits (123), Expect = 7e-08 Identities = 24/78 (30%), Positives = 42/78 (53%) Frame = +1 Query: 256 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDXPSSPXKCKFEPPLXHPNVYPSGTVXLSL 435 ++ W+ I G +P+ GG++ + + F D P P K F + HPN+ +G++ L + Sbjct: 29 DMFHWQATIMGPAESPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDI 88 Query: 436 L*LKKXXGXPAITIKQIL 489 L K PA+TI ++L Sbjct: 89 L---KEQWSPALTISKVL 103 >At2g16740.1 68415.m01920 ubiquitin-conjugating enzyme, putative strong similarity to SP|P35133 Ubiquitin-conjugating enzyme E2-17 kDa 10 (EC 6.3.2.19) (Ubiquitin- protein ligase 10) (Ubiquitin carrier protein 10) {Arabidopsis thaliana}; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 148 Score = 53.6 bits (123), Expect = 7e-08 Identities = 24/78 (30%), Positives = 41/78 (52%) Frame = +1 Query: 256 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDXPSSPXKCKFEPPLXHPNVYPSGTVXLSL 435 ++ W+ I G +P+ GG++ + + F D P P K F + HPN+ +G + L + Sbjct: 29 DMFHWQATIMGPNESPYSGGVFLVNIHFPPDYPFKPPKVVFRTKVFHPNINSNGNICLDI 88 Query: 436 L*LKKXXGXPAITIKQIL 489 L K PA+TI ++L Sbjct: 89 L---KDQWSPALTISKVL 103 >At5g56150.2 68418.m07005 ubiquitin-conjugating enzyme, putative strong similarity to ubiquitin-conjugating enzyme UBC2 [Mesembryanthemum crystallinum] GI:5762457, UBC4 [Pisum sativum] GI:456568; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 148 Score = 53.2 bits (122), Expect = 9e-08 Identities = 23/78 (29%), Positives = 42/78 (53%) Frame = +1 Query: 256 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDXPSSPXKCKFEPPLXHPNVYPSGTVXLSL 435 ++ W+ I G +P+ GG++ + + F D P P K F + HPN+ +G++ L + Sbjct: 29 DMFQWQATIMGPADSPFAGGVFLVTIHFPPDYPFKPPKVAFRTKVYHPNINSNGSICLDI 88 Query: 436 L*LKKXXGXPAITIKQIL 489 L K PA+T+ ++L Sbjct: 89 L---KEQWSPALTVSKVL 103 >At5g56150.1 68418.m07004 ubiquitin-conjugating enzyme, putative strong similarity to ubiquitin-conjugating enzyme UBC2 [Mesembryanthemum crystallinum] GI:5762457, UBC4 [Pisum sativum] GI:456568; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 148 Score = 53.2 bits (122), Expect = 9e-08 Identities = 23/78 (29%), Positives = 42/78 (53%) Frame = +1 Query: 256 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDXPSSPXKCKFEPPLXHPNVYPSGTVXLSL 435 ++ W+ I G +P+ GG++ + + F D P P K F + HPN+ +G++ L + Sbjct: 29 DMFQWQATIMGPADSPFAGGVFLVTIHFPPDYPFKPPKVAFRTKVYHPNINSNGSICLDI 88 Query: 436 L*LKKXXGXPAITIKQIL 489 L K PA+T+ ++L Sbjct: 89 L---KEQWSPALTVSKVL 103 >At5g50870.1 68418.m06304 ubiquitin-conjugating enzyme, putative strong similarity to ubiquitin conjugating enzyme [Lycopersicon esculentum] GI:886679; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 192 Score = 53.2 bits (122), Expect = 9e-08 Identities = 29/79 (36%), Positives = 41/79 (51%), Gaps = 1/79 (1%) Frame = +1 Query: 256 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDXPSSPXKCKFEPPLXHPNV-YPSGTVXLS 432 NL IPG GTP+EGG +++ + D P P K +F + HPN+ SG + L Sbjct: 31 NLTRLTGTIPGPIGTPYEGGTFQIDITMPDGYPFEPPKMQFSTKVWHPNISSQSGAICLD 90 Query: 433 LL*LKKXXGXPAITIKQIL 489 +L K PA+T+K L Sbjct: 91 IL---KDQWSPALTLKTAL 106 >At5g41700.3 68418.m05068 ubiquitin-conjugating enzyme 8 (UBC8) E2; identical to gi:297882, SP:P35131 Length = 145 Score = 52.0 bits (119), Expect = 2e-07 Identities = 23/77 (29%), Positives = 41/77 (53%) Frame = +1 Query: 256 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDXPSSPXKCKFEPPLXHPNVYPSGTVXLSL 435 ++ W+ I G +P+ GG++ + + F D P P K F + HPN+ +G++ L + Sbjct: 29 DMFHWQATIMGPAESPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDI 88 Query: 436 L*LKKXXGXPAITIKQI 486 L K PA+TI ++ Sbjct: 89 L---KEQWSPALTISKV 102 >At3g55380.1 68416.m06151 ubiquitin-conjugating enzyme 14 (UBC14) E2; UbcAT3; identical to gi:2129757, S46656 Length = 167 Score = 52.0 bits (119), Expect = 2e-07 Identities = 23/61 (37%), Positives = 32/61 (52%) Frame = +1 Query: 256 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDXPSSPXKCKFEPPLXHPNVYPSGTVXLSL 435 N+ W +I G T +EGG + M F ++ P SP F + HPNVY G V +S+ Sbjct: 34 NVFQWSVSIMGPPDTLYEGGFFNAIMSFPENYPVSPPTVTFTSEMWHPNVYSDGKVCISI 93 Query: 436 L 438 L Sbjct: 94 L 94 >At3g08700.1 68416.m01011 ubiquitin-conjugating enzyme, putative strong similar to ubiquitin-conjugating enzymes E2-17 from [Arabidopsis thaliana] SP|P35134, SP|P35132, SP|P35133; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 149 Score = 51.2 bits (117), Expect = 4e-07 Identities = 23/78 (29%), Positives = 40/78 (51%) Frame = +1 Query: 256 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDXPSSPXKCKFEPPLXHPNVYPSGTVXLSL 435 ++ W+ I G +P+ GG++ + + F D P P K F+ + HPN+ G++ L + Sbjct: 30 DIFHWQATIMGPHDSPYSGGVFTVSIDFSSDYPFKPPKVNFKTKVYHPNIDSKGSICLDI 89 Query: 436 L*LKKXXGXPAITIKQIL 489 L K PA T ++L Sbjct: 90 L---KEQWSPAPTTSKVL 104 >At3g20060.1 68416.m02537 ubiquitin-conjugating enzyme 19 (UBC19) nearly identical to ubiquitin-conjugating enzyme UBC19 [Arabidopsis thaliana] GI:22530865; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 181 Score = 50.8 bits (116), Expect = 5e-07 Identities = 24/61 (39%), Positives = 32/61 (52%) Frame = +1 Query: 256 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDXPSSPXKCKFEPPLXHPNVYPSGTVXLSL 435 N+ W+ I G K T +EG Y+L + F +D P K KFE HPNV G + L + Sbjct: 64 NIFCWKGTITGSKDTVFEGTEYRLSLTFSNDYPFKSPKVKFETCCFHPNVDLYGNICLDI 123 Query: 436 L 438 L Sbjct: 124 L 124 >At5g05080.1 68418.m00539 ubiquitin-conjugating enzyme, putative similar to SP|Q16763 Ubiquitin-conjugating enzyme E2-24 kDa (EC 6.3.2.19) (Ubiquitin- protein ligase) (Ubiquitin carrier protein) {Homo sapiens}; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 251 Score = 50.4 bits (115), Expect = 6e-07 Identities = 25/73 (34%), Positives = 41/73 (56%), Gaps = 1/73 (1%) Frame = +1 Query: 274 CA-IPGKKGTPWEGGLYKLRMIFKDDXPSSPXKCKFEPPLXHPNVYPSGTVXLSLL*LKK 450 CA I G GTP+E GL+++++ D P SP K F + HPNV +G + ++ L K Sbjct: 43 CADIEGPVGTPYENGLFRMKLALSHDFPHSPPKGYFMTKIFHPNVASNGEICVNTL---K 99 Query: 451 XXGXPAITIKQIL 489 P++ ++ +L Sbjct: 100 KDWNPSLGLRHVL 112 >At5g25760.1 68418.m03057 ubiquitin-conjugating enzyme, putative similar to SP|O60015 Ubiquitin-conjugating enzyme E2-21 kDa (EC 6.3.2.19) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) {Pichia angusta}; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 157 Score = 48.4 bits (110), Expect = 3e-06 Identities = 24/78 (30%), Positives = 40/78 (51%), Gaps = 1/78 (1%) Frame = +1 Query: 256 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDXPSSPXKCKFEPPLXHPNV-YPSGTVXLS 432 N+ W I G TP+EGG+++L + P P + +F + HPNV + +G + L Sbjct: 33 NIFKWTALIKGPSETPYEGGVFQLAFSVPEPYPLQPPQVRFLTKIFHPNVHFKTGEICLD 92 Query: 433 LL*LKKXXGXPAITIKQI 486 +L K PA T++ + Sbjct: 93 IL---KNAWSPAWTLQSV 107 >At1g78870.2 68414.m09194 ubiquitin-conjugating enzyme, putative nearly identical to ubiquitin-conjugating enzyme E2 [Catharanthus roseus] GI:5381319; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 153 Score = 47.6 bits (108), Expect = 4e-06 Identities = 23/78 (29%), Positives = 41/78 (52%) Frame = +1 Query: 256 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDXPSSPXKCKFEPPLXHPNVYPSGTVXLSL 435 N+ + I G +P+EGG++KL + ++ P + K +F + HPN+ G + L + Sbjct: 33 NMRYFNVMILGPTQSPYEGGVFKLELFLPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDI 92 Query: 436 L*LKKXXGXPAITIKQIL 489 L K PA+ I+ +L Sbjct: 93 L---KDKWSPALQIRTVL 107 >At1g78870.1 68414.m09193 ubiquitin-conjugating enzyme, putative nearly identical to ubiquitin-conjugating enzyme E2 [Catharanthus roseus] GI:5381319; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 112 Score = 47.6 bits (108), Expect = 4e-06 Identities = 23/78 (29%), Positives = 41/78 (52%) Frame = +1 Query: 256 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDXPSSPXKCKFEPPLXHPNVYPSGTVXLSL 435 N+ + I G +P+EGG++KL + ++ P + K +F + HPN+ G + L + Sbjct: 33 NMRYFNVMILGPTQSPYEGGVFKLELFLPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDI 92 Query: 436 L*LKKXXGXPAITIKQIL 489 L K PA+ I+ +L Sbjct: 93 L---KDKWSPALQIRTVL 107 >At1g16890.2 68414.m02044 ubiquitin-conjugating enzyme, putative nearly identical to ubiquitin-conjugating enzyme E2 [Catharanthus roseus] GI:5381319; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 153 Score = 47.6 bits (108), Expect = 4e-06 Identities = 23/78 (29%), Positives = 41/78 (52%) Frame = +1 Query: 256 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDXPSSPXKCKFEPPLXHPNVYPSGTVXLSL 435 N+ + I G +P+EGG++KL + ++ P + K +F + HPN+ G + L + Sbjct: 33 NMRYFNVMILGPTQSPYEGGVFKLELFLPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDI 92 Query: 436 L*LKKXXGXPAITIKQIL 489 L K PA+ I+ +L Sbjct: 93 L---KDKWSPALQIRTVL 107 >At1g16890.1 68414.m02043 ubiquitin-conjugating enzyme, putative nearly identical to ubiquitin-conjugating enzyme E2 [Catharanthus roseus] GI:5381319; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 120 Score = 46.0 bits (104), Expect = 1e-05 Identities = 22/70 (31%), Positives = 38/70 (54%) Frame = +1 Query: 280 IPGKKGTPWEGGLYKLRMIFKDDXPSSPXKCKFEPPLXHPNVYPSGTVXLSLL*LKKXXG 459 I G +P+EGG++KL + ++ P + K +F + HPN+ G + L +L K Sbjct: 8 ILGPTQSPYEGGVFKLELFLPEEYPMAAPKVRFLTKIYHPNIDKLGRICLDIL---KDKW 64 Query: 460 XPAITIKQIL 489 PA+ I+ +L Sbjct: 65 SPALQIRTVL 74 >At2g32790.1 68415.m04014 ubiquitin-conjugating enzyme, putative similar to ubiquitin conjugating enzyme from [Oryza sativa] GI:1373001, {Arabidopsis thaliana} SP|P35134, SP|P35131; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 177 Score = 44.4 bits (100), Expect = 4e-05 Identities = 17/61 (27%), Positives = 30/61 (49%) Frame = +1 Query: 256 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDXPSSPXKCKFEPPLXHPNVYPSGTVXLSL 435 N+ WE + G G P+E G++ + + P P K F+ + HPN+ G + + + Sbjct: 58 NIFRWEATVNGPVGCPYEKGVFTVSVHIPPKYPYEPPKITFKTKIFHPNISEIGEIFVDI 117 Query: 436 L 438 L Sbjct: 118 L 118 >At3g15355.1 68416.m01945 ubiquitin-conjugating enzyme-related similar to ubiquitin-conjugating enzyme (GI:3319990) [Mus musculus]; similar to Baculoviral IAP repeat-containing protein 6 (Ubiquitin-conjugating BIR-domain enzyme apollon) (Swiss-Prot:Q9NR09) [Homo sapiens]; Length = 609 Score = 39.9 bits (89), Expect = 9e-04 Identities = 31/80 (38%), Positives = 42/80 (52%), Gaps = 2/80 (2%) Frame = +1 Query: 205 PSLWFCREAYEESRWFMNLMTWECAIPGKKGTPWEGGLYKLRMIFKDDXPSSPXKCKFEP 384 P + F R AYE SR M+L+ I G +GTP+ GL+ + F D PS+P + Sbjct: 349 PEMIFVR-AYE-SR--MDLL--RAVIIGAQGTPYHDGLFFFDIFFPDTYPSTPPIVHYHS 402 Query: 385 P--LXHPNVYPSGTVXLSLL 438 +PN+Y G V LSLL Sbjct: 403 GGLRINPNLYNCGKVCLSLL 422 >At1g53020.1 68414.m06002 ubiquitin-conjugating enzyme family protein similar to ubiquitin-conjugating enzyme GB:3319990 from [Mus musculus]; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 1163 Score = 38.3 bits (85), Expect = 0.003 Identities = 21/55 (38%), Positives = 29/55 (52%), Gaps = 2/55 (3%) Frame = +1 Query: 280 IPGKKGTPWEGGLYKLRMIFKDDXPSSPXKCKFEPP--LXHPNVYPSGTVXLSLL 438 I G +GTP+ GL+ + F D PS P K + +PN+Y G V LSL+ Sbjct: 641 IIGAEGTPYHDGLFFFDIQFPDTYPSVPPKVHYHSGGLRINPNLYKCGKVCLSLI 695 Score = 36.7 bits (81), Expect = 0.008 Identities = 21/55 (38%), Positives = 28/55 (50%), Gaps = 2/55 (3%) Frame = +1 Query: 280 IPGKKGTPWEGGLYKLRMIFKDDXPSSPXKCKFEPP--LXHPNVYPSGTVXLSLL 438 I G +GTP+ GL+ + F D PS P + +PN+Y G V LSLL Sbjct: 307 IIGAEGTPYHDGLFFFDIQFPDTYPSVPPNVHYHSGGLRINPNLYNCGKVCLSLL 361 Score = 32.7 bits (71), Expect = 0.14 Identities = 18/54 (33%), Positives = 27/54 (50%), Gaps = 2/54 (3%) Frame = +1 Query: 280 IPGKKGTPWEGGLYKLRMIFKDDXPSSPXKCKFEPP--LXHPNVYPSGTVXLSL 435 I G +GTP+ GL+ + F D PS P + +PN+Y G V +S+ Sbjct: 953 IIGAEGTPYHDGLFFFDIQFPDTYPSVPPNVYYHSGGLRINPNLYNCGKVLVSI 1006 >At2g16920.1 68415.m01949 ubiquitin-conjugating enzyme family protein low similarity to ubiquitin-conjugating BIR-domain enzyme APOLLON [Homo sapiens] GI:8489831, ubiquitin-conjugating enzyme [Mus musculus] GI:3319990; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 1102 Score = 35.1 bits (77), Expect = 0.026 Identities = 25/72 (34%), Positives = 34/72 (47%), Gaps = 2/72 (2%) Frame = +1 Query: 229 AYEESRWFMNLMTWECAIPGKKGTPWEGGLYKLRMIFKDDXPSSPXKCKFEPP--LXHPN 402 AYE+ M+L+ I G GTP++ GL+ D PS P + +PN Sbjct: 874 AYEDR---MDLL--RAVIVGAFGTPYQDGLFFFDFHLPSDYPSVPPSAYYHSGGWRLNPN 928 Query: 403 VYPSGTVXLSLL 438 +Y G V LSLL Sbjct: 929 LYEEGKVCLSLL 940 >At2g33770.1 68415.m04141 ubiquitin-conjugating enzyme family protein low similarity to ubiquitin-conjugating BIR-domain enzyme APOLLON [Homo sapiens] GI:8489831, ubiquitin-conjugating enzyme [Mus musculus] GI:3319990; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 907 Score = 34.7 bits (76), Expect = 0.034 Identities = 19/56 (33%), Positives = 27/56 (48%), Gaps = 2/56 (3%) Frame = +1 Query: 277 AIPGKKGTPWEGGLYKLRMIFKDDXPSSPXKCKFEPP--LXHPNVYPSGTVXLSLL 438 A+ G GTP+ GL+ ++ P P + +PN+Y SG V LSLL Sbjct: 697 ALVGAPGTPYHDGLFFFDIMLPPQYPHEPPMVHYHSGGMRLNPNLYESGRVCLSLL 752 >At1g63800.1 68414.m07220 ubiquitin-conjugating enzyme 5 (UBC5) E2; identical to gi:431269, SP:P42749 Length = 185 Score = 33.9 bits (74), Expect = 0.059 Identities = 18/52 (34%), Positives = 28/52 (53%), Gaps = 1/52 (1%) Frame = +1 Query: 286 GKKGTPWEGGLYKLRMIFKDDXPSSPXKCKFEPPLXHPNV-YPSGTVXLSLL 438 G K + +EGG++K+R+ D P F + HPNV SG+V L ++ Sbjct: 38 GPKDSIYEGGVWKIRVELPDAYPYKSPSVGFITKIYHPNVDEMSGSVCLDVI 89 >At1g70660.1 68414.m08146 ubiquitin-conjugating enzyme family protein similar to TRAF6-regulated IKK activator 1 beta Uev1A [Homo sapiens] GI:10880969; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 159 Score = 33.1 bits (72), Expect = 0.10 Identities = 15/55 (27%), Positives = 26/55 (47%) Frame = +1 Query: 259 LMTWECAIPGKKGTPWEGGLYKLRMIFKDDXPSSPXKCKFEPPLXHPNVYPSGTV 423 + +W I G T +EG +++L++ D P SP +F+ + V P V Sbjct: 44 MQSWTGTILGPHNTAYEGKIFQLKLFCGKDYPESPPTVRFQSRINMACVNPENGV 98 >At5g41340.1 68418.m05024 ubiquitin-conjugating enzyme 4 (UBC4) E2; identical to gi:431265, SP:P42748 Length = 187 Score = 32.7 bits (71), Expect = 0.14 Identities = 17/52 (32%), Positives = 28/52 (53%), Gaps = 1/52 (1%) Frame = +1 Query: 286 GKKGTPWEGGLYKLRMIFKDDXPSSPXKCKFEPPLXHPNVYP-SGTVXLSLL 438 G K + ++GG++K+R+ D P F + HPNV SG+V L ++ Sbjct: 38 GPKDSLYQGGVWKIRVELPDAYPYKSPSVGFITKIYHPNVDELSGSVCLDVI 89 >At1g23260.1 68414.m02910 ubiquitin-conjugating enzyme family protein similar to TRAF6-regulated IKK activator 1 beta Uev1A [Homo sapiens] GI:10880969; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 158 Score = 32.3 bits (70), Expect = 0.18 Identities = 17/60 (28%), Positives = 30/60 (50%), Gaps = 1/60 (1%) Frame = +1 Query: 259 LMTWECAIPGKKGTPWEGGLYKLRMIFKDDXPSSPXKCKFEPPLXHPNVYP-SGTVXLSL 435 + +W I G T +EG +++L++ + P SP +F+ + V P +G V SL Sbjct: 44 MQSWTGTILGPPNTAYEGKIFQLKLFCGKEYPESPPTVRFQTRINMACVNPETGVVEPSL 103 >At5g50430.1 68418.m06245 ubiquitin-conjugating enzyme, putative similar to ubiquitin conjugating enzyme 6 from [Homo sapiens] GI:14029267, [Mus musculus] GI:14029263; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 243 Score = 31.9 bits (69), Expect = 0.24 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = +1 Query: 256 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDXPSSP 363 +++ W + G +GTP+ GG Y ++ F + P P Sbjct: 33 DILEWHYVLEGSEGTPFAGGFYYGKIKFPPEYPYKP 68 >At3g17000.1 68416.m02171 ubiquitin-conjugating enzyme, putative similar to Non-Canonical UBiquitin Conjugating Enzyme 1 (NCUBE1) from [Gallus gallus] GI:7362937, [Mus musculus] GI:7363050, [Homo sapiens] GI:7362973; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 309 Score = 31.9 bits (69), Expect = 0.24 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +1 Query: 256 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDXPSSP 363 N+ W+ AI G T +EGG+Y R+ D P P Sbjct: 39 NIFEWQFAIRGPGDTEFEGGIYHGRIQLPADYPFKP 74 >At1g17280.1 68414.m02105 ubiquitin-conjugating enzyme, putative similar to ubiquitin conjugating enzyme 6 from [Homo sapiens] GI:14029267, [Mus musculus] GI:14029263; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 237 Score = 31.9 bits (69), Expect = 0.24 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = +1 Query: 256 NLMTWECAIPGKKGTPWEGGLYKLRMIFKDDXPSSP 363 +++ W + G +GTP+ GG Y ++ F + P P Sbjct: 33 DILEWHYVLEGSEGTPFAGGFYYGKIKFPPEYPYKP 68 >At3g52560.1 68416.m05784 ubiquitin-conjugating enzyme family protein similar to DNA-binding protein CROC-1B [Homo sapiens] GI:1066082; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 146 Score = 29.1 bits (62), Expect = 1.7 Identities = 12/40 (30%), Positives = 19/40 (47%) Frame = +1 Query: 259 LMTWECAIPGKKGTPWEGGLYKLRMIFKDDXPSSPXKCKF 378 + +W I G T EG +Y+L++ D P P +F Sbjct: 46 MRSWTGTIIGPHNTVHEGRIYQLKLFCDKDYPEKPPTVRF 85 >At2g36060.1 68415.m04427 ubiquitin-conjugating enzyme family protein similar to DNA-binding protein CROC-1B [Homo sapiens] GI:1066082; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 145 Score = 29.1 bits (62), Expect = 1.7 Identities = 12/40 (30%), Positives = 19/40 (47%) Frame = +1 Query: 259 LMTWECAIPGKKGTPWEGGLYKLRMIFKDDXPSSPXKCKF 378 + +W I G T EG +Y+L++ D P P +F Sbjct: 45 MRSWTGTIIGPHNTVHEGRIYQLKLFCDKDYPEKPPTVRF 84 >At4g13680.1 68417.m02126 hypothetical protein contains Pfam profile PF03478: Protein of unknown function (DUF295) Length = 354 Score = 27.5 bits (58), Expect = 5.1 Identities = 12/25 (48%), Positives = 12/25 (48%) Frame = +1 Query: 202 GPSLWFCREAYEESRWFMNLMTWEC 276 GP L FCR A S W MT C Sbjct: 164 GPQLSFCRPAQSNSEWINIRMTDPC 188 >At2g46030.1 68415.m05726 ubiquitin-conjugating enzyme 6 (UBC6) E2; identical to gi|431267, SP:P42750, PIR:S52661; contains a ubiquitin-conjugating enzymes active site (PDOC00163) Length = 183 Score = 27.5 bits (58), Expect = 5.1 Identities = 14/52 (26%), Positives = 26/52 (50%), Gaps = 1/52 (1%) Frame = +1 Query: 286 GKKGTPWEGGLYKLRMIFKDDXPSSPXKCKFEPPLXHPNV-YPSGTVXLSLL 438 G + ++GG++K+++ + P F + HPNV SG V L ++ Sbjct: 38 GPTDSLYQGGVWKIKVELPEAYPYKSPSVGFVNKIYHPNVDESSGAVCLDVI 89 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,730,384 Number of Sequences: 28952 Number of extensions: 196828 Number of successful extensions: 457 Number of sequences better than 10.0: 49 Number of HSP's better than 10.0 without gapping: 429 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 451 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 848837888 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -