BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0574 (360 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF990672-1|ABS30733.1| 466|Anopheles gambiae voltage-gated calc... 23 3.5 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 23 3.5 AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. 23 4.6 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 23 4.6 AY062207-1|AAL58568.1| 504|Anopheles gambiae cytochrome P450 CY... 22 8.0 >EF990672-1|ABS30733.1| 466|Anopheles gambiae voltage-gated calcium channel beta subunitprotein. Length = 466 Score = 23.0 bits (47), Expect = 3.5 Identities = 15/50 (30%), Positives = 23/50 (46%) Frame = -1 Query: 216 ETLGVCERNIRRSGPVALVVGDDLHLPVLEDTNARVRGTQIDSYCGXFCH 67 + LG E+ RS PVA V ++ D ++ V G+ + G F H Sbjct: 72 QALGQLEK--ARSKPVAFAVRTNVSYDGSLDDDSPVHGSAVSFEVGDFLH 119 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 23.0 bits (47), Expect = 3.5 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +3 Query: 66 NGKSXRSRNRSGYHVLLRWCLPAREGGDHR 155 +GK RS + +++LL P REG H+ Sbjct: 1802 DGKYKRSYSYEPHNLLLSNLFPPREGFHHK 1831 >AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. Length = 1132 Score = 22.6 bits (46), Expect = 4.6 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +2 Query: 155 PTTXATGPLRLMLRSQTPSVSSEMP 229 P A+G R LR + +VSSE+P Sbjct: 506 PGAGASGASRKRLRISSGNVSSEIP 530 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 22.6 bits (46), Expect = 4.6 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = -2 Query: 116 QEYVVPRSIPTAGAFA 69 Q+Y PR++ +AG FA Sbjct: 1244 QDYAPPRALMSAGGFA 1259 >AY062207-1|AAL58568.1| 504|Anopheles gambiae cytochrome P450 CYP6S2 protein. Length = 504 Score = 21.8 bits (44), Expect = 8.0 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +1 Query: 172 RTTPSYVAFTDTERL 216 +T PSY+AF D R+ Sbjct: 426 KTNPSYLAFGDGPRM 440 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 364,127 Number of Sequences: 2352 Number of extensions: 7002 Number of successful extensions: 12 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 57 effective length of database: 429,915 effective search space used: 26654730 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -