BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0572 (676 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC13G1.02 |||mannose-1-phosphate guanyltransferase |Schizosacc... 29 0.81 SPBC609.02 |ptn1||phosphatidylinositol-3,4,5-trisphosphate3-phos... 25 7.6 SPAC926.09c |fas1||fatty acid synthase beta subunit Fas1|Schizos... 25 10.0 SPAC1486.06 |||nicotinate phosphoribosyltransferase |Schizosacch... 25 10.0 >SPBC13G1.02 |||mannose-1-phosphate guanyltransferase |Schizosaccharomyces pombe|chr 2|||Manual Length = 414 Score = 28.7 bits (61), Expect = 0.81 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = +1 Query: 97 CGFYFHNASITQNLRRAAEKLYEDPIEEVERRL 195 CG Y +ASI +++A YE +EEVE++L Sbjct: 183 CGIYIFDASIFDEIKKA----YERRLEEVEKQL 211 >SPBC609.02 |ptn1||phosphatidylinositol-3,4, 5-trisphosphate3-phosphatase|Schizosaccharomyces pombe|chr 2|||Manual Length = 348 Score = 25.4 bits (53), Expect = 7.6 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = -3 Query: 617 KRSLKFFLQGVFLLASSWSLVPNSARDD 534 ++ + FLQG ++ SWS + NS R D Sbjct: 307 QQGINSFLQGQQSISFSWSEMDNSRRSD 334 >SPAC926.09c |fas1||fatty acid synthase beta subunit Fas1|Schizosaccharomyces pombe|chr 1|||Manual Length = 2073 Score = 25.0 bits (52), Expect = 10.0 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -1 Query: 244 GHVSDHQFYLVGRWLSIISFPPLLWD 167 G D + YL G W + PP+ +D Sbjct: 762 GGADDTEPYLTGEWSAAFKLPPMPFD 787 >SPAC1486.06 |||nicotinate phosphoribosyltransferase |Schizosaccharomyces pombe|chr 1|||Manual Length = 410 Score = 25.0 bits (52), Expect = 10.0 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +1 Query: 37 TPAGKFGSAIAIGSLLIGAGCGF 105 +P G+F A G LI AGC F Sbjct: 145 SPEGQFEKAYEKGKRLIRAGCAF 167 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,431,457 Number of Sequences: 5004 Number of extensions: 46460 Number of successful extensions: 97 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 96 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 97 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 309878492 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -