BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0572 (676 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_38691| Best HMM Match : UPF0014 (HMM E-Value=2.2) 29 2.6 SB_1787| Best HMM Match : Peptidase_S9 (HMM E-Value=1.5e-08) 28 6.0 >SB_38691| Best HMM Match : UPF0014 (HMM E-Value=2.2) Length = 430 Score = 29.5 bits (63), Expect = 2.6 Identities = 13/35 (37%), Positives = 24/35 (68%), Gaps = 3/35 (8%) Frame = -1 Query: 220 YLVGRWLSI---ISFPPLLWDPHIIFLQLDEDSVL 125 +LVG+W+++ S PLL++ ++ +Q DED V+ Sbjct: 334 WLVGQWVNVKLTASVRPLLYESLLLLMQKDEDLVM 368 >SB_1787| Best HMM Match : Peptidase_S9 (HMM E-Value=1.5e-08) Length = 1057 Score = 28.3 bits (60), Expect = 6.0 Identities = 19/51 (37%), Positives = 29/51 (56%), Gaps = 1/51 (1%) Frame = +1 Query: 115 NASITQNLRRAAEKLYEDPIEEVERRL-LIASGLPNRTGDQIRALIDGMSA 264 NA + +NLR A EKL E E+++ L + SG N + +Q+R L + A Sbjct: 728 NAQLRRNLRMANEKLQEQ--REIQQSLEELKSGHTNVSFEQVRQLKSELEA 776 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,464,794 Number of Sequences: 59808 Number of extensions: 322439 Number of successful extensions: 590 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 555 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 590 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1733301648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -