BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0567 (659 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_0811 - 6113491-6113925,6114079-6114185,6114569-6114788,611... 28 7.6 >06_01_0811 - 6113491-6113925,6114079-6114185,6114569-6114788, 6115112-6115199,6115301-6115431,6115924-6116099, 6116465-6116529,6117014-6117094,6117219-6117358, 6117446-6117532,6117614-6117827,6118102-6118260, 6118860-6118936,6119629-6119796 Length = 715 Score = 27.9 bits (59), Expect = 7.6 Identities = 18/47 (38%), Positives = 31/47 (65%) Frame = -3 Query: 270 FHIRSLQVRTLTGKKTLSSISVARIKNMAYIARHARPTAASNLNLLN 130 F I + V +LT ++T SS+S+ I +M +AR+A P + + LNL++ Sbjct: 408 FRIGMMVVYSLTPRQT-SSVSLLMICSM--VARYAAPISYNFLNLIH 451 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,107,022 Number of Sequences: 37544 Number of extensions: 185595 Number of successful extensions: 267 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 263 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 267 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1655832080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -