BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0559 (476 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain tran... 24 0.83 AF230313-1|AAF64147.1| 210|Tribolium castaneum labial protein p... 24 0.83 AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein p... 24 0.83 DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. 23 1.9 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 23 1.9 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 23 1.9 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 23 1.9 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 23 1.9 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 3.3 EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetyla... 21 4.4 DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc gr... 21 4.4 >AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain transcription factor Labialprotein. Length = 353 Score = 23.8 bits (49), Expect = 0.83 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -2 Query: 250 RHHIRVINRHAHYFSNSIRFQ 188 RHH V + H H+F + ++Q Sbjct: 117 RHHEEVADGHQHHFLHENKYQ 137 >AF230313-1|AAF64147.1| 210|Tribolium castaneum labial protein protein. Length = 210 Score = 23.8 bits (49), Expect = 0.83 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -2 Query: 250 RHHIRVINRHAHYFSNSIRFQ 188 RHH V + H H+F + ++Q Sbjct: 117 RHHEEVADGHQHHFLHENKYQ 137 >AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein protein. Length = 253 Score = 23.8 bits (49), Expect = 0.83 Identities = 8/21 (38%), Positives = 13/21 (61%) Frame = -2 Query: 250 RHHIRVINRHAHYFSNSIRFQ 188 RHH V + H H+F + ++Q Sbjct: 117 RHHEEVADGHQHHFLHENKYQ 137 >DQ493452-1|ABF48588.1| 305|Tribolium castaneum hedgehog protein. Length = 305 Score = 22.6 bits (46), Expect = 1.9 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -2 Query: 109 YNLLSRRQLTNIHLISGRIFE*ISSRQLIXD 17 YN +RQ +I L SGR S L+ D Sbjct: 157 YNPSQKRQFLHITLASGRTLTVTPSHLLVLD 187 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 22.6 bits (46), Expect = 1.9 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +2 Query: 8 RIKVGDQLPAADLFEDSPANK 70 R V +PA D+FE+ NK Sbjct: 1507 RNSVASSIPAKDVFENGHVNK 1527 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 22.6 bits (46), Expect = 1.9 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +2 Query: 8 RIKVGDQLPAADLFEDSPANK 70 R V +PA D+FE+ NK Sbjct: 1507 RNSVASSIPAKDVFENGHVNK 1527 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 22.6 bits (46), Expect = 1.9 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +2 Query: 8 RIKVGDQLPAADLFEDSPANK 70 R V +PA D+FE+ NK Sbjct: 1507 RNSVASSIPAKDVFENGHVNK 1527 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 22.6 bits (46), Expect = 1.9 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +2 Query: 8 RIKVGDQLPAADLFEDSPANK 70 R V +PA D+FE+ NK Sbjct: 1507 RNSVASSIPAKDVFENGHVNK 1527 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.8 bits (44), Expect = 3.3 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -1 Query: 254 KPPSHTGH*QTRT 216 +PPS T H QT+T Sbjct: 1175 RPPSTTNHWQTKT 1187 >EU019711-1|ABU25223.1| 534|Tribolium castaneum chitin deacetylase 1 protein. Length = 534 Score = 21.4 bits (43), Expect = 4.4 Identities = 13/43 (30%), Positives = 17/43 (39%) Frame = +2 Query: 164 GYVQNADKLKSDGVAEIVCVSVNDPYVMAAWELSTTLKERCVC 292 G N +K SDG E C NDP + + + C C Sbjct: 133 GLFCNGEKDCSDGSDENTCDIDNDPNRAPPCDPAVCVLPDCFC 175 >DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc growth factor 2 protein. Length = 439 Score = 21.4 bits (43), Expect = 4.4 Identities = 13/37 (35%), Positives = 17/37 (45%) Frame = +2 Query: 125 GAFTPGCSKTHLPGYVQNADKLKSDGVAEIVCVSVND 235 G F G T GY + K K G IV +S++D Sbjct: 383 GGFWVGYEDTDTAGYKASYVKAKGLGGIAIVDLSLDD 419 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 112,735 Number of Sequences: 336 Number of extensions: 2613 Number of successful extensions: 14 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 11141978 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -