BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0557 (547 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 22 3.5 AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 21 6.2 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 21 8.2 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 21 8.2 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 21 8.2 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 22.2 bits (45), Expect = 3.5 Identities = 12/39 (30%), Positives = 17/39 (43%) Frame = -3 Query: 320 IAFFNRPSNFIHTFLEHFPSENSDNCVIAPYLIKTTVSS 204 I N + + FL+ FP +NS V LI + S Sbjct: 12 ILLLNLTTQDVDGFLQGFPGKNSPYTVTQAILIALVLGS 50 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 21.4 bits (43), Expect = 6.2 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = -2 Query: 60 VWRDSRTVGGRAR*P 16 VWRD+R V G + P Sbjct: 147 VWRDARIVNGTRQPP 161 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.0 bits (42), Expect = 8.2 Identities = 7/16 (43%), Positives = 12/16 (75%) Frame = -2 Query: 162 LCVVSRSVGGIRIRSL 115 LC+V+ SVGG + ++ Sbjct: 286 LCIVNNSVGGESVETV 301 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 21.0 bits (42), Expect = 8.2 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -1 Query: 160 VCCLSLSWRDTDKILTAGRTLGV 92 V CL RDT + +GR L + Sbjct: 533 VACLLFHHRDTPVVRASGRELTI 555 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 21.0 bits (42), Expect = 8.2 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -1 Query: 160 VCCLSLSWRDTDKILTAGRTLGV 92 V CL RDT + +GR L + Sbjct: 623 VACLLFHHRDTPVVRASGRELTI 645 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 123,969 Number of Sequences: 438 Number of extensions: 2088 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15581757 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -