BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0551 (633 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 23 1.6 U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 21 8.6 AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 21 8.6 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 23.4 bits (48), Expect = 1.6 Identities = 17/52 (32%), Positives = 22/52 (42%) Frame = +2 Query: 446 LNSSDVFI*TISLIISENICNFVWCYYSNFNLYLXRXNFXLXCCKQYSNPXT 601 +N VFI L + +C W S N +L R N L +Q NP T Sbjct: 505 MNLGGVFIWATDLDDFKGVCGMKWPLLSTINRHL-RGN-ELLPMQQSQNPPT 554 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 21.0 bits (42), Expect = 8.6 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +1 Query: 334 PSPNSLELCEMLPRERPEA 390 P N E + PRERP A Sbjct: 302 PGQNPGEKTNIAPRERPRA 320 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 21.0 bits (42), Expect = 8.6 Identities = 11/34 (32%), Positives = 14/34 (41%) Frame = +2 Query: 335 PHQTAWNYVKCYHEKDPKHALFL*THNPTQPFHT 436 PH+ Y +C H K + A P FHT Sbjct: 484 PHELCDKYYRCVHGKPTEFAC-----RPGTVFHT 512 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 136,296 Number of Sequences: 336 Number of extensions: 2889 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 16292796 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -