BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0551 (633 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146736-1|AAO12096.1| 131|Anopheles gambiae odorant-binding pr... 52 2e-08 AJ697723-1|CAG26916.1| 131|Anopheles gambiae putative odorant-b... 52 2e-08 AJ697721-1|CAG26914.1| 135|Anopheles gambiae putative odorant-b... 41 3e-05 AY146738-1|AAO12098.1| 134|Anopheles gambiae odorant-binding pr... 38 2e-04 AY146733-1|AAO12093.1| 131|Anopheles gambiae odorant-binding pr... 38 3e-04 AJ697724-1|CAG26917.1| 131|Anopheles gambiae putative odorant-b... 38 3e-04 AY146728-1|AAO12088.1| 131|Anopheles gambiae odorant-binding pr... 36 8e-04 AY146727-1|AAO12087.1| 139|Anopheles gambiae odorant-binding pr... 36 0.001 AY146734-1|AAO12094.1| 176|Anopheles gambiae odorant-binding pr... 32 0.013 AY146731-1|AAO12091.1| 150|Anopheles gambiae odorant-binding pr... 31 0.030 AF437887-1|AAL84182.1| 150|Anopheles gambiae odorant binding pr... 31 0.030 AF437885-1|AAL84180.1| 157|Anopheles gambiae odorant binding pr... 30 0.053 AY146722-1|AAO12082.1| 107|Anopheles gambiae odorant-binding pr... 27 0.65 AY146720-1|AAO12080.1| 147|Anopheles gambiae odorant-binding pr... 27 0.65 AY146719-1|AAO12079.1| 159|Anopheles gambiae odorant-binding pr... 25 2.0 EF519384-1|ABP68493.1| 506|Anopheles gambiae LRIM1 protein. 24 3.5 EF519383-1|ABP68492.1| 506|Anopheles gambiae LRIM1 protein. 24 3.5 EF519382-1|ABP68491.1| 493|Anopheles gambiae LRIM1 protein. 24 3.5 EF519381-1|ABP68490.1| 506|Anopheles gambiae LRIM1 protein. 24 3.5 EF519380-1|ABP68489.1| 506|Anopheles gambiae LRIM1 protein. 24 3.5 EF519376-1|ABP68485.1| 506|Anopheles gambiae LRIM1 protein. 24 3.5 EF519375-1|ABP68484.1| 493|Anopheles gambiae LRIM1 protein. 24 3.5 EF519374-1|ABP68483.1| 506|Anopheles gambiae LRIM1 protein. 24 3.5 EF519373-1|ABP68482.1| 506|Anopheles gambiae LRIM1 protein. 24 3.5 EF519372-1|ABP68481.1| 506|Anopheles gambiae LRIM1 protein. 24 3.5 EF519371-1|ABP68480.1| 506|Anopheles gambiae LRIM1 protein. 24 3.5 EF519370-1|ABP68479.1| 452|Anopheles gambiae LRIM1 protein. 24 3.5 EF519369-1|ABP68478.1| 506|Anopheles gambiae LRIM1 protein. 24 3.5 EF519368-1|ABP68477.1| 506|Anopheles gambiae LRIM1 protein. 24 3.5 EF519367-1|ABP68476.1| 506|Anopheles gambiae LRIM1 protein. 24 3.5 EF519366-1|ABP68475.1| 506|Anopheles gambiae LRIM1 protein. 24 3.5 EF519365-1|ABP68474.1| 486|Anopheles gambiae LRIM1 protein. 24 3.5 EF519364-1|ABP68473.1| 496|Anopheles gambiae LRIM1 protein. 24 3.5 EF519363-1|ABP68472.1| 503|Anopheles gambiae LRIM1 protein. 24 3.5 EF519362-1|ABP68471.1| 506|Anopheles gambiae LRIM1 protein. 24 3.5 EF519361-1|ABP68470.1| 497|Anopheles gambiae LRIM1 protein. 24 3.5 EF519360-1|ABP68469.1| 499|Anopheles gambiae LRIM1 protein. 24 3.5 EF519359-1|ABP68468.1| 506|Anopheles gambiae LRIM1 protein. 24 3.5 EF519358-1|ABP68467.1| 497|Anopheles gambiae LRIM1 protein. 24 3.5 EF519357-1|ABP68466.1| 506|Anopheles gambiae LRIM1 protein. 24 3.5 EF519356-1|ABP68465.1| 500|Anopheles gambiae LRIM1 protein. 24 3.5 EF519355-1|ABP68464.1| 506|Anopheles gambiae LRIM1 protein. 24 3.5 EF519354-1|ABP68463.1| 506|Anopheles gambiae LRIM1 protein. 24 3.5 EF519353-1|ABP68462.1| 470|Anopheles gambiae LRIM1 protein. 24 3.5 EF519352-1|ABP68461.1| 448|Anopheles gambiae LRIM1 protein. 24 3.5 EF519351-1|ABP68460.1| 486|Anopheles gambiae LRIM1 protein. 24 3.5 EF519350-1|ABP68459.1| 421|Anopheles gambiae LRIM1 protein. 24 3.5 EF519349-1|ABP68458.1| 486|Anopheles gambiae LRIM1 protein. 24 3.5 EF519348-1|ABP68457.1| 503|Anopheles gambiae LRIM1 protein. 24 3.5 EF519347-1|ABP68456.1| 470|Anopheles gambiae LRIM1 protein. 24 3.5 DQ396551-1|ABD60146.1| 354|Anopheles gambiae adipokinetic hormo... 24 3.5 DQ370035-1|ABD18596.1| 93|Anopheles gambiae defensin protein. 24 3.5 AY298745-1|AAQ63187.1| 354|Anopheles gambiae G-protein coupled ... 24 3.5 AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P... 24 3.5 AY146721-1|AAO12081.1| 144|Anopheles gambiae odorant-binding pr... 24 3.5 AF437884-1|AAL84179.1| 144|Anopheles gambiae odorant binding pr... 24 3.5 AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 23 8.1 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 23 8.1 AF513638-1|AAM53610.1| 210|Anopheles gambiae glutathione S-tran... 23 8.1 >AY146736-1|AAO12096.1| 131|Anopheles gambiae odorant-binding protein AgamOBP26 protein. Length = 131 Score = 52.0 bits (119), Expect = 2e-08 Identities = 28/79 (35%), Positives = 43/79 (54%), Gaps = 2/79 (2%) Frame = +3 Query: 6 MKTFIVFVVCVVLAQ--ALTDEQKENLKKHRADCLSETKADEQLVNKLKTGDFKTENEPL 179 MKTF+ V ++A ALT +QK+ + + A+C+ T + KLK GDF ++ Sbjct: 1 MKTFVAIAVVALIAGTFALTIDQKKKAEGYAAECVKTTGVPPETAAKLKGGDFAGADDKT 60 Query: 180 KKYALCMLIKSQLMTKDGK 236 K +A C L K+ MT G+ Sbjct: 61 KCFAKCFLEKAGFMTDKGE 79 >AJ697723-1|CAG26916.1| 131|Anopheles gambiae putative odorant-binding protein OBPjj13 protein. Length = 131 Score = 52.0 bits (119), Expect = 2e-08 Identities = 28/79 (35%), Positives = 43/79 (54%), Gaps = 2/79 (2%) Frame = +3 Query: 6 MKTFIVFVVCVVLAQ--ALTDEQKENLKKHRADCLSETKADEQLVNKLKTGDFKTENEPL 179 MKTF+ V ++A ALT +QK+ + + A+C+ T + KLK GDF ++ Sbjct: 1 MKTFVAIAVVALIAGTFALTIDQKKKAEGYAAECVKTTGVPPETAAKLKGGDFAGADDKT 60 Query: 180 KKYALCMLIKSQLMTKDGK 236 K +A C L K+ MT G+ Sbjct: 61 KCFAKCFLEKAGFMTDKGE 79 >AJ697721-1|CAG26914.1| 135|Anopheles gambiae putative odorant-binding protein OBPjj11 protein. Length = 135 Score = 41.1 bits (92), Expect = 3e-05 Identities = 19/75 (25%), Positives = 39/75 (52%) Frame = +3 Query: 24 FVVCVVLAQALTDEQKENLKKHRADCLSETKADEQLVNKLKTGDFKTENEPLKKYALCML 203 F+ C V +++EQ+E ++ C+ +T A E VN+L++GD + + + + C Sbjct: 13 FIACAVAT--ISEEQREAARQLAGKCMQQTGASEDDVNRLRSGDTEGADRNTRCFVQCFF 70 Query: 204 IKSQLMTKDGKFKKD 248 + + +DG + D Sbjct: 71 QGAGFVDQDGSVQTD 85 >AY146738-1|AAO12098.1| 134|Anopheles gambiae odorant-binding protein AgamOBP28 protein. Length = 134 Score = 38.3 bits (85), Expect = 2e-04 Identities = 25/79 (31%), Positives = 37/79 (46%), Gaps = 2/79 (2%) Frame = +3 Query: 18 IVFVVCVVLAQALTDEQKENLKKHRADCLSETKA--DEQLVNKLKTGDFKTENEPLKKYA 191 ++ VC AQ LTD+Q + + CL + K E LV L+ GDF + K + Sbjct: 8 VLLAVCAA-AQPLTDDQMKKAEGFALGCLEQHKGLNKEHLV-LLRDGDFSKVDADTKCFL 65 Query: 192 LCMLIKSQLMTKDGKFKKD 248 C L ++ M GK + D Sbjct: 66 RCFLQQANFMDAAGKLQND 84 >AY146733-1|AAO12093.1| 131|Anopheles gambiae odorant-binding protein AgamOBP23 protein. Length = 131 Score = 37.5 bits (83), Expect = 3e-04 Identities = 21/82 (25%), Positives = 36/82 (43%), Gaps = 3/82 (3%) Frame = +3 Query: 6 MKTFIV---FVVCVVLAQALTDEQKENLKKHRADCLSETKADEQLVNKLKTGDFKTENEP 176 MK+F F + V A T Q++ + +C++ET + + KL+ GD + Sbjct: 1 MKSFFCVASFFLLVASVHAFTLRQQKMVSIFALECMAETGIGAESLTKLRDGDLTANDRT 60 Query: 177 LKKYALCMLIKSQLMTKDGKFK 242 K + C K M +GK + Sbjct: 61 AKCFMKCFFEKENFMDAEGKLQ 82 >AJ697724-1|CAG26917.1| 131|Anopheles gambiae putative odorant-binding protein OBPjj14 protein. Length = 131 Score = 37.5 bits (83), Expect = 3e-04 Identities = 21/82 (25%), Positives = 36/82 (43%), Gaps = 3/82 (3%) Frame = +3 Query: 6 MKTFIV---FVVCVVLAQALTDEQKENLKKHRADCLSETKADEQLVNKLKTGDFKTENEP 176 MK+F F + V A T Q++ + +C++ET + + KL+ GD + Sbjct: 1 MKSFFCVASFFLLVASVHAFTLRQQKMVSIFALECMAETGIGAESLTKLRDGDLTANDRT 60 Query: 177 LKKYALCMLIKSQLMTKDGKFK 242 K + C K M +GK + Sbjct: 61 AKCFMKCFFEKENFMDAEGKLQ 82 >AY146728-1|AAO12088.1| 131|Anopheles gambiae odorant-binding protein AgamOBP21 protein. Length = 131 Score = 36.3 bits (80), Expect = 8e-04 Identities = 26/80 (32%), Positives = 35/80 (43%), Gaps = 2/80 (2%) Frame = +3 Query: 18 IVFVVCVVLAQALTDEQKENLKKHRADCLSETKAD--EQLVNKLKTGDFKTENEPLKKYA 191 IVFVV +LA T EQ E K C +E + E K++ GD ++E K Sbjct: 6 IVFVV--LLAAVSTMEQHEIAKSLAEQCRAELGGELPEDFATKMRLGDLTLDSETAKCTI 63 Query: 192 LCMLIKSQLMTKDGKFKKDV 251 CM K + G +DV Sbjct: 64 QCMFAKVGFTLESGAANRDV 83 Score = 30.3 bits (65), Expect = 0.053 Identities = 12/41 (29%), Positives = 20/41 (48%) Frame = +2 Query: 254 LAKVPNAEDKLKVEKLIDACLANKGNSPHQTAWNYVKCYHE 376 +AK+ K E D C N+G + A++ +CYH+ Sbjct: 85 IAKLSKGNPTAKAEAFADVCENNEGETACDKAFSLYQCYHK 125 >AY146727-1|AAO12087.1| 139|Anopheles gambiae odorant-binding protein AgamOBP20 protein. Length = 139 Score = 35.9 bits (79), Expect = 0.001 Identities = 22/55 (40%), Positives = 29/55 (52%) Frame = +3 Query: 90 RADCLSETKADEQLVNKLKTGDFKTENEPLKKYALCMLIKSQLMTKDGKFKKDVA 254 R+ CL +TK E+LVN L+ F E LK Y C++ Q M K GK D + Sbjct: 33 RSVCLGKTKVAEELVNGLRESKFADVKE-LKCYVNCVMEMMQTM-KKGKLNYDAS 85 >AY146734-1|AAO12094.1| 176|Anopheles gambiae odorant-binding protein AgamOBP24 protein. Length = 176 Score = 32.3 bits (70), Expect = 0.013 Identities = 16/66 (24%), Positives = 31/66 (46%) Frame = +3 Query: 54 LTDEQKENLKKHRADCLSETKADEQLVNKLKTGDFKTENEPLKKYALCMLIKSQLMTKDG 233 L E + ++ +C+ ET + ++ +GDF + K + C L K+ + DG Sbjct: 48 LEAEHVRRIHQNARECVKETGILPKNAFRVLSGDFSVDTMKAKCFVKCFLDKAGFIDDDG 107 Query: 234 KFKKDV 251 ++DV Sbjct: 108 VIQQDV 113 >AY146731-1|AAO12091.1| 150|Anopheles gambiae odorant-binding protein AgamOBP4 protein. Length = 150 Score = 31.1 bits (67), Expect = 0.030 Identities = 22/78 (28%), Positives = 41/78 (52%), Gaps = 4/78 (5%) Frame = +3 Query: 51 ALTDEQKEN-LKKHRADCLSETKADEQLVNKLKTGDFKTE-NEPLKKYALCMLIKSQLMT 224 A+T +Q N + R C + K +E ++ L+ F ++ LK YA+C+ + MT Sbjct: 26 AMTMKQLTNSMDMMRQACAPKFKVEEAELHGLRKSIFPANPDKELKCYAMCIAQMAGTMT 85 Query: 225 KDGK--FKKDVAWLKCLM 272 K G+ F K +A ++ ++ Sbjct: 86 KKGEISFSKTMAQIEAML 103 >AF437887-1|AAL84182.1| 150|Anopheles gambiae odorant binding protein protein. Length = 150 Score = 31.1 bits (67), Expect = 0.030 Identities = 22/78 (28%), Positives = 41/78 (52%), Gaps = 4/78 (5%) Frame = +3 Query: 51 ALTDEQKEN-LKKHRADCLSETKADEQLVNKLKTGDFKTE-NEPLKKYALCMLIKSQLMT 224 A+T +Q N + R C + K +E ++ L+ F ++ LK YA+C+ + MT Sbjct: 26 AMTMKQLTNSMDMMRQACAPKFKVEEAELHGLRKSIFPANPDKELKCYAMCIAQMAGTMT 85 Query: 225 KDGK--FKKDVAWLKCLM 272 K G+ F K +A ++ ++ Sbjct: 86 KKGEISFSKTMAQIEAML 103 >AF437885-1|AAL84180.1| 157|Anopheles gambiae odorant binding protein protein. Length = 157 Score = 30.3 bits (65), Expect = 0.053 Identities = 19/68 (27%), Positives = 31/68 (45%) Frame = +2 Query: 188 CSMYADQITADDQGREIQEGRRLAKVPNAEDKLKVEKLIDACLANKGNSPHQTAWNYVKC 367 C +T DD+G E+ G+ L VP + + + + C KG + A+ + KC Sbjct: 89 CMFRVTNVT-DDRG-ELHMGKLLEHVPTEFEDIALRMGV-RCTRPKGKDVCERAFWFHKC 145 Query: 368 YHEKDPKH 391 + DP H Sbjct: 146 WKTSDPVH 153 Score = 25.4 bits (53), Expect = 1.5 Identities = 12/34 (35%), Positives = 15/34 (44%) Frame = +3 Query: 99 CLSETKADEQLVNKLKTGDFKTENEPLKKYALCM 200 CL ET + V + D +N LK Y CM Sbjct: 57 CLEETGVSPEAVKRFSDADPFDDNRALKCYMDCM 90 >AY146722-1|AAO12082.1| 107|Anopheles gambiae odorant-binding protein AgamOBP16 protein. Length = 107 Score = 26.6 bits (56), Expect = 0.65 Identities = 11/51 (21%), Positives = 26/51 (50%) Frame = +3 Query: 48 QALTDEQKENLKKHRADCLSETKADEQLVNKLKTGDFKTENEPLKKYALCM 200 ++L+ E + + + R++CL ET ++ + + + + L+ Y CM Sbjct: 22 KSLSPELLQQMGQFRSECLRETGTTDEQIEQFNSPQSVQASHELQCYMYCM 72 >AY146720-1|AAO12080.1| 147|Anopheles gambiae odorant-binding protein AgamOBP15 protein. Length = 147 Score = 26.6 bits (56), Expect = 0.65 Identities = 11/51 (21%), Positives = 26/51 (50%) Frame = +3 Query: 48 QALTDEQKENLKKHRADCLSETKADEQLVNKLKTGDFKTENEPLKKYALCM 200 ++L+ E + + + R++CL ET ++ + + + + L+ Y CM Sbjct: 22 KSLSPELLQQMGQFRSECLRETGTTDEQIEQFNSPQSVQASHELQCYMYCM 72 >AY146719-1|AAO12079.1| 159|Anopheles gambiae odorant-binding protein AgamOBP2 protein. Length = 159 Score = 25.0 bits (52), Expect = 2.0 Identities = 11/34 (32%), Positives = 15/34 (44%) Frame = +3 Query: 99 CLSETKADEQLVNKLKTGDFKTENEPLKKYALCM 200 CL ET + + + D +N LK Y CM Sbjct: 57 CLEETGVSPEAIKRFSDADPFDDNRALKCYMDCM 90 >EF519384-1|ABP68493.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 3.5 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 278 DKLKVEKLIDACLANKGNSPHQTAWN 355 ++ K+EK+ D+ L S Q+AWN Sbjct: 32 NRYKIEKVTDSSLKQALASLRQSAWN 57 >EF519383-1|ABP68492.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 3.5 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 278 DKLKVEKLIDACLANKGNSPHQTAWN 355 ++ K+EK+ D+ L S Q+AWN Sbjct: 32 NRYKIEKVTDSSLKQALASLRQSAWN 57 >EF519382-1|ABP68491.1| 493|Anopheles gambiae LRIM1 protein. Length = 493 Score = 24.2 bits (50), Expect = 3.5 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 278 DKLKVEKLIDACLANKGNSPHQTAWN 355 ++ K+EK+ D+ L S Q+AWN Sbjct: 32 NRYKIEKVTDSSLKQALASLRQSAWN 57 >EF519381-1|ABP68490.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 3.5 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 278 DKLKVEKLIDACLANKGNSPHQTAWN 355 ++ K+EK+ D+ L S Q+AWN Sbjct: 32 NRYKIEKVTDSSLKQALASLRQSAWN 57 >EF519380-1|ABP68489.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 3.5 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 278 DKLKVEKLIDACLANKGNSPHQTAWN 355 ++ K+EK+ D+ L S Q+AWN Sbjct: 32 NRYKIEKVTDSSLKQALASLRQSAWN 57 >EF519376-1|ABP68485.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 3.5 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 278 DKLKVEKLIDACLANKGNSPHQTAWN 355 ++ K+EK+ D+ L S Q+AWN Sbjct: 32 NRYKIEKVTDSSLKQALASLRQSAWN 57 >EF519375-1|ABP68484.1| 493|Anopheles gambiae LRIM1 protein. Length = 493 Score = 24.2 bits (50), Expect = 3.5 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 278 DKLKVEKLIDACLANKGNSPHQTAWN 355 ++ K+EK+ D+ L S Q+AWN Sbjct: 32 NRYKIEKVTDSSLKQALASLRQSAWN 57 >EF519374-1|ABP68483.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 3.5 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 278 DKLKVEKLIDACLANKGNSPHQTAWN 355 ++ K+EK+ D+ L S Q+AWN Sbjct: 32 NRYKIEKVTDSSLKQALASLRQSAWN 57 >EF519373-1|ABP68482.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 3.5 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 278 DKLKVEKLIDACLANKGNSPHQTAWN 355 ++ K+EK+ D+ L S Q+AWN Sbjct: 32 NRYKIEKVTDSSLKQALASLRQSAWN 57 >EF519372-1|ABP68481.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 3.5 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 278 DKLKVEKLIDACLANKGNSPHQTAWN 355 ++ K+EK+ D+ L S Q+AWN Sbjct: 32 NRYKIEKVTDSSLKQALASLRQSAWN 57 >EF519371-1|ABP68480.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 3.5 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 278 DKLKVEKLIDACLANKGNSPHQTAWN 355 ++ K+EK+ D+ L S Q+AWN Sbjct: 32 NRYKIEKVTDSSLKQALASLRQSAWN 57 >EF519370-1|ABP68479.1| 452|Anopheles gambiae LRIM1 protein. Length = 452 Score = 24.2 bits (50), Expect = 3.5 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 278 DKLKVEKLIDACLANKGNSPHQTAWN 355 ++ K+EK+ D+ L S Q+AWN Sbjct: 17 NRYKIEKVTDSSLKQALASLRQSAWN 42 >EF519369-1|ABP68478.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 3.5 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 278 DKLKVEKLIDACLANKGNSPHQTAWN 355 ++ K+EK+ D+ L S Q+AWN Sbjct: 32 NRYKIEKVTDSSLKQALASLRQSAWN 57 >EF519368-1|ABP68477.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 3.5 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 278 DKLKVEKLIDACLANKGNSPHQTAWN 355 ++ K+EK+ D+ L S Q+AWN Sbjct: 32 NRYKIEKVTDSSLKQALASLRQSAWN 57 >EF519367-1|ABP68476.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 3.5 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 278 DKLKVEKLIDACLANKGNSPHQTAWN 355 ++ K+EK+ D+ L S Q+AWN Sbjct: 32 NRYKIEKVTDSSLKQALASLRQSAWN 57 >EF519366-1|ABP68475.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 3.5 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 278 DKLKVEKLIDACLANKGNSPHQTAWN 355 ++ K+EK+ D+ L S Q+AWN Sbjct: 32 NRYKIEKVTDSSLKQALASLRQSAWN 57 >EF519365-1|ABP68474.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 24.2 bits (50), Expect = 3.5 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 278 DKLKVEKLIDACLANKGNSPHQTAWN 355 ++ K+EK+ D+ L S Q+AWN Sbjct: 32 NRYKIEKVTDSSLKQALASLRQSAWN 57 >EF519364-1|ABP68473.1| 496|Anopheles gambiae LRIM1 protein. Length = 496 Score = 24.2 bits (50), Expect = 3.5 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 278 DKLKVEKLIDACLANKGNSPHQTAWN 355 ++ K+EK+ D+ L S Q+AWN Sbjct: 32 NRYKIEKVTDSSLKQALASLRQSAWN 57 >EF519363-1|ABP68472.1| 503|Anopheles gambiae LRIM1 protein. Length = 503 Score = 24.2 bits (50), Expect = 3.5 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 278 DKLKVEKLIDACLANKGNSPHQTAWN 355 ++ K+EK+ D+ L S Q+AWN Sbjct: 32 NRYKIEKVTDSSLKQALASLRQSAWN 57 >EF519362-1|ABP68471.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 3.5 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 278 DKLKVEKLIDACLANKGNSPHQTAWN 355 ++ K+EK+ D+ L S Q+AWN Sbjct: 32 NRYKIEKVTDSSLKQALASLRQSAWN 57 >EF519361-1|ABP68470.1| 497|Anopheles gambiae LRIM1 protein. Length = 497 Score = 24.2 bits (50), Expect = 3.5 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 278 DKLKVEKLIDACLANKGNSPHQTAWN 355 ++ K+EK+ D+ L S Q+AWN Sbjct: 32 NRYKIEKVTDSSLKQALASLRQSAWN 57 >EF519360-1|ABP68469.1| 499|Anopheles gambiae LRIM1 protein. Length = 499 Score = 24.2 bits (50), Expect = 3.5 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 278 DKLKVEKLIDACLANKGNSPHQTAWN 355 ++ K+EK+ D+ L S Q+AWN Sbjct: 32 NRYKIEKVTDSSLKQALASLRQSAWN 57 >EF519359-1|ABP68468.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 3.5 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 278 DKLKVEKLIDACLANKGNSPHQTAWN 355 ++ K+EK+ D+ L S Q+AWN Sbjct: 32 NRYKIEKVTDSSLKQALASLRQSAWN 57 >EF519358-1|ABP68467.1| 497|Anopheles gambiae LRIM1 protein. Length = 497 Score = 24.2 bits (50), Expect = 3.5 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 278 DKLKVEKLIDACLANKGNSPHQTAWN 355 ++ K+EK+ D+ L S Q+AWN Sbjct: 32 NRYKIEKVTDSSLKQALASLRQSAWN 57 >EF519357-1|ABP68466.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 3.5 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 278 DKLKVEKLIDACLANKGNSPHQTAWN 355 ++ K+EK+ D+ L S Q+AWN Sbjct: 32 NRYKIEKVTDSSLKQALASLRQSAWN 57 >EF519356-1|ABP68465.1| 500|Anopheles gambiae LRIM1 protein. Length = 500 Score = 24.2 bits (50), Expect = 3.5 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 278 DKLKVEKLIDACLANKGNSPHQTAWN 355 ++ K+EK+ D+ L S Q+AWN Sbjct: 32 NRYKIEKVTDSSLKQALASLRQSAWN 57 >EF519355-1|ABP68464.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 3.5 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 278 DKLKVEKLIDACLANKGNSPHQTAWN 355 ++ K+EK+ D+ L S Q+AWN Sbjct: 32 NRYKIEKVTDSSLKQALASLRQSAWN 57 >EF519354-1|ABP68463.1| 506|Anopheles gambiae LRIM1 protein. Length = 506 Score = 24.2 bits (50), Expect = 3.5 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 278 DKLKVEKLIDACLANKGNSPHQTAWN 355 ++ K+EK+ D+ L S Q+AWN Sbjct: 32 NRYKIEKVTDSSLKQALASLRQSAWN 57 >EF519353-1|ABP68462.1| 470|Anopheles gambiae LRIM1 protein. Length = 470 Score = 24.2 bits (50), Expect = 3.5 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 278 DKLKVEKLIDACLANKGNSPHQTAWN 355 ++ K+EK+ D+ L S Q+AWN Sbjct: 32 NRYKIEKVTDSSLKQALASLRQSAWN 57 >EF519352-1|ABP68461.1| 448|Anopheles gambiae LRIM1 protein. Length = 448 Score = 24.2 bits (50), Expect = 3.5 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 278 DKLKVEKLIDACLANKGNSPHQTAWN 355 ++ K+EK+ D+ L S Q+AWN Sbjct: 32 NRYKIEKVTDSSLKQALASLRQSAWN 57 >EF519351-1|ABP68460.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 24.2 bits (50), Expect = 3.5 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 278 DKLKVEKLIDACLANKGNSPHQTAWN 355 ++ K+EK+ D+ L S Q+AWN Sbjct: 32 NRYKIEKVTDSSLKQALASLRQSAWN 57 >EF519350-1|ABP68459.1| 421|Anopheles gambiae LRIM1 protein. Length = 421 Score = 24.2 bits (50), Expect = 3.5 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 278 DKLKVEKLIDACLANKGNSPHQTAWN 355 ++ K+EK+ D+ L S Q+AWN Sbjct: 32 NRYKIEKVTDSSLKQALASLRQSAWN 57 >EF519349-1|ABP68458.1| 486|Anopheles gambiae LRIM1 protein. Length = 486 Score = 24.2 bits (50), Expect = 3.5 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 278 DKLKVEKLIDACLANKGNSPHQTAWN 355 ++ K+EK+ D+ L S Q+AWN Sbjct: 32 NRYKIEKVTDSSLKQALASLRQSAWN 57 >EF519348-1|ABP68457.1| 503|Anopheles gambiae LRIM1 protein. Length = 503 Score = 24.2 bits (50), Expect = 3.5 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 278 DKLKVEKLIDACLANKGNSPHQTAWN 355 ++ K+EK+ D+ L S Q+AWN Sbjct: 32 NRYKIEKVTDSSLKQALASLRQSAWN 57 >EF519347-1|ABP68456.1| 470|Anopheles gambiae LRIM1 protein. Length = 470 Score = 24.2 bits (50), Expect = 3.5 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = +2 Query: 278 DKLKVEKLIDACLANKGNSPHQTAWN 355 ++ K+EK+ D+ L S Q+AWN Sbjct: 32 NRYKIEKVTDSSLKQALASLRQSAWN 57 >DQ396551-1|ABD60146.1| 354|Anopheles gambiae adipokinetic hormone receptor protein. Length = 354 Score = 24.2 bits (50), Expect = 3.5 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = +3 Query: 477 YH*LYRRIFAILYGVIILTLIY 542 YH I+ I+Y V+++ L+Y Sbjct: 200 YHYFEEEIYQIIYNVLVMCLMY 221 >DQ370035-1|ABD18596.1| 93|Anopheles gambiae defensin protein. Length = 93 Score = 24.2 bits (50), Expect = 3.5 Identities = 16/56 (28%), Positives = 24/56 (42%), Gaps = 4/56 (7%) Frame = +3 Query: 3 IMKTFI----VFVVCVVLAQALTDEQKENLKKHRADCLSETKADEQLVNKLKTGDF 158 IMK+FI + ++C + T + K AD +S V K KTG + Sbjct: 13 IMKSFIAAAVIALICAIAVSGTTVTLQSTCKLFTADVVSSITCKMYCVIKGKTGGY 68 >AY298745-1|AAQ63187.1| 354|Anopheles gambiae G-protein coupled receptor protein. Length = 354 Score = 24.2 bits (50), Expect = 3.5 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = +3 Query: 477 YH*LYRRIFAILYGVIILTLIY 542 YH I+ I+Y V+++ L+Y Sbjct: 200 YHYFEEEIYQIIYNVLVMCLMY 221 >AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P450 reductase protein. Length = 679 Score = 24.2 bits (50), Expect = 3.5 Identities = 10/31 (32%), Positives = 19/31 (61%) Frame = +1 Query: 355 LCEMLPRERPEARSFLVNT*SNPTVPYLISV 447 +CE+LPR +P S ++ +PT ++ +V Sbjct: 447 VCELLPRLQPRYHSISSSSKLHPTTVHVTAV 477 >AY146721-1|AAO12081.1| 144|Anopheles gambiae odorant-binding protein AgamOBP1 protein. Length = 144 Score = 24.2 bits (50), Expect = 3.5 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +2 Query: 311 CLANKGNSPHQTAWNYVKCYHEKDPKH 391 CL +G + A+ KC+ + DPKH Sbjct: 114 CLYPEGETLCDKAFWLHKCWKQSDPKH 140 >AF437884-1|AAL84179.1| 144|Anopheles gambiae odorant binding protein protein. Length = 144 Score = 24.2 bits (50), Expect = 3.5 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +2 Query: 311 CLANKGNSPHQTAWNYVKCYHEKDPKH 391 CL +G + A+ KC+ + DPKH Sbjct: 114 CLYPEGETLCDKAFWLHKCWKQSDPKH 140 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 23.0 bits (47), Expect = 8.1 Identities = 10/27 (37%), Positives = 12/27 (44%) Frame = +2 Query: 503 CNFVWCYYSNFNLYLXRXNFXLXCCKQ 583 CN VW SN L + NF + Q Sbjct: 2351 CNSVWTILSNEGLIGPKSNFSMTAINQ 2377 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 23.0 bits (47), Expect = 8.1 Identities = 10/27 (37%), Positives = 12/27 (44%) Frame = +2 Query: 503 CNFVWCYYSNFNLYLXRXNFXLXCCKQ 583 CN VW SN L + NF + Q Sbjct: 2352 CNSVWTILSNEGLIGPKSNFSMTAINQ 2378 >AF513638-1|AAM53610.1| 210|Anopheles gambiae glutathione S-transferase D3 protein. Length = 210 Score = 23.0 bits (47), Expect = 8.1 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = +3 Query: 3 IMKTFIVFVVCVVLAQALTDEQKENLKK 86 + K I + VV + TDEQ E LKK Sbjct: 103 LYKQIIDIIHLVVKKEQPTDEQMEKLKK 130 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 602,522 Number of Sequences: 2352 Number of extensions: 11581 Number of successful extensions: 85 Number of sequences better than 10.0: 59 Number of HSP's better than 10.0 without gapping: 82 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 84 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 61886940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -