BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0549 (452 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB083010-1|BAC54131.1| 132|Apis mellifera fatty acid binding pr... 96 2e-22 AB083011-1|BAC54132.1| 135|Apis mellifera fatty acid binding pr... 45 3e-07 AF134817-1|AAD40233.1| 105|Apis mellifera FABP-like protein pro... 45 4e-07 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 23 2.1 DQ855484-1|ABH88171.1| 130|Apis mellifera chemosensory protein ... 21 6.3 AJ973401-1|CAJ01448.1| 130|Apis mellifera hypothetical protein ... 21 6.3 AF481963-1|AAN59784.1| 130|Apis mellifera antennal-specific pro... 21 6.3 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 21 8.3 >AB083010-1|BAC54131.1| 132|Apis mellifera fatty acid binding protein protein. Length = 132 Score = 95.9 bits (228), Expect = 2e-22 Identities = 42/71 (59%), Positives = 57/71 (80%) Frame = +3 Query: 42 EFVGKKYKMTSSENFDEFMKTIGVGLITRKAANAVTPTVELRKDGDEYNLVTSSTFKTTE 221 +F+GK+YK+ SSENFD+FMK +GVG++TRK ++V+P VEL ++ Y L T+S FK TE Sbjct: 3 DFLGKRYKLYSSENFDDFMKALGVGIMTRKVGSSVSPVVELTENNGLYTLKTTSPFKNTE 62 Query: 222 MKFKPGEEFEE 254 +KFK GEEFEE Sbjct: 63 IKFKLGEEFEE 73 Score = 44.0 bits (99), Expect = 8e-07 Identities = 23/42 (54%), Positives = 26/42 (61%) Frame = +2 Query: 266 GAKVKSVCTFEGNTLKQVXKAPXGLEVTYXREFGPEEMKAVM 391 G KVKSVCT +GN L QV K + T REF EMKA+M Sbjct: 78 GRKVKSVCTLDGNKLIQVQKGEK--QTTIEREFSSTEMKAIM 117 >AB083011-1|BAC54132.1| 135|Apis mellifera fatty acid binding protein protein. Length = 135 Score = 45.2 bits (102), Expect = 3e-07 Identities = 26/73 (35%), Positives = 37/73 (50%) Frame = +3 Query: 39 MEFVGKKYKMTSSENFDEFMKTIGVGLITRKAANAVTPTVELRKDGDEYNLVTSSTFKTT 218 ++F GK ++ S NF+EF K +G + P+ EL K+GDE+ +SS T Sbjct: 2 VQFEGK-FQFVSQNNFEEFAKVLGDQNLVNTVLQP-RPSFELSKNGDEWTFTSSSGDNTY 59 Query: 219 EMKFKPGEEFEET 257 FK FEET Sbjct: 60 TKTFKMNVPFEET 72 >AF134817-1|AAD40233.1| 105|Apis mellifera FABP-like protein protein. Length = 105 Score = 44.8 bits (101), Expect = 4e-07 Identities = 26/72 (36%), Positives = 36/72 (50%) Frame = +3 Query: 42 EFVGKKYKMTSSENFDEFMKTIGVGLITRKAANAVTPTVELRKDGDEYNLVTSSTFKTTE 221 +F GK ++ S NF+EF K +G + P+ EL K+GDE+ +SS T Sbjct: 1 QFEGK-FQFVSQNNFEEFAKVLGDQNLVNTVLQP-RPSFELSKNGDEWTFTSSSGDNTYT 58 Query: 222 MKFKPGEEFEET 257 FK FEET Sbjct: 59 KTFKMNVPFEET 70 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 22.6 bits (46), Expect = 2.1 Identities = 8/25 (32%), Positives = 17/25 (68%) Frame = -2 Query: 226 FISVVLKVEEVTKLYSSPSLRSSTV 152 FIS+++ +E+ + +SP L + T+ Sbjct: 9 FISLIILNDEIYNIIASPQLNNPTL 33 >DQ855484-1|ABH88171.1| 130|Apis mellifera chemosensory protein 3 protein. Length = 130 Score = 21.0 bits (42), Expect = 6.3 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = +2 Query: 287 CTFEGNTLKQV 319 CT EGN LK+V Sbjct: 57 CTAEGNELKRV 67 >AJ973401-1|CAJ01448.1| 130|Apis mellifera hypothetical protein protein. Length = 130 Score = 21.0 bits (42), Expect = 6.3 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = +2 Query: 287 CTFEGNTLKQV 319 CT EGN LK+V Sbjct: 57 CTAEGNELKRV 67 >AF481963-1|AAN59784.1| 130|Apis mellifera antennal-specific protein 3c precursor protein. Length = 130 Score = 21.0 bits (42), Expect = 6.3 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = +2 Query: 287 CTFEGNTLKQV 319 CT EGN LK+V Sbjct: 57 CTAEGNELKRV 67 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 20.6 bits (41), Expect = 8.3 Identities = 11/31 (35%), Positives = 13/31 (41%) Frame = +3 Query: 96 MKTIGVGLITRKAANAVTPTVELRKDGDEYN 188 MKTI G + V E K G EY+ Sbjct: 513 MKTIKKGSFVTQYVGEVITNEEAEKRGKEYD 543 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 110,790 Number of Sequences: 438 Number of extensions: 1860 Number of successful extensions: 13 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11943513 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -