BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0549 (452 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g69850.1 68414.m08039 nitrate transporter (NTL1) identical to... 27 4.5 At1g27040.2 68414.m03296 nitrate transporter, putative contains ... 27 4.5 At1g27040.1 68414.m03297 nitrate transporter, putative contains ... 27 4.5 >At1g69850.1 68414.m08039 nitrate transporter (NTL1) identical to nitrate transporter (NTL1) GI:3377517 [Arabidopsis thaliana] Length = 585 Score = 27.5 bits (58), Expect = 4.5 Identities = 14/38 (36%), Positives = 21/38 (55%) Frame = +3 Query: 63 KMTSSENFDEFMKTIGVGLITRKAANAVTPTVELRKDG 176 K T +E ++ IGVGL+ A AV VE+++ G Sbjct: 414 KATKTETGVTHLQRIGVGLVLSILAMAVAALVEIKRKG 451 >At1g27040.2 68414.m03296 nitrate transporter, putative contains Pfam profile: PF00854 POT family; similar to nitrate transporter (NTL1) GI:3377517 [Arabidopsis thaliana] Length = 563 Score = 27.5 bits (58), Expect = 4.5 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = +3 Query: 63 KMTSSENFDEFMKTIGVGLITRKAANAVTPTVELRK 170 K+T SE ++ IGVGL+ A AV VEL++ Sbjct: 393 KVTKSEIGITHLQRIGVGLVLSIVAMAVAALVELKR 428 >At1g27040.1 68414.m03297 nitrate transporter, putative contains Pfam profile: PF00854 POT family; similar to nitrate transporter (NTL1) GI:3377517 [Arabidopsis thaliana] Length = 567 Score = 27.5 bits (58), Expect = 4.5 Identities = 15/36 (41%), Positives = 21/36 (58%) Frame = +3 Query: 63 KMTSSENFDEFMKTIGVGLITRKAANAVTPTVELRK 170 K+T SE ++ IGVGL+ A AV VEL++ Sbjct: 397 KVTKSEIGITHLQRIGVGLVLSIVAMAVAALVELKR 432 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,595,239 Number of Sequences: 28952 Number of extensions: 150445 Number of successful extensions: 392 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 365 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 392 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 742437000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -