BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0547 (472 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_7038| Best HMM Match : No HMM Matches (HMM E-Value=.) 130 6e-31 SB_1215| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_20469| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_50641| Best HMM Match : Rad21_Rec8_N (HMM E-Value=0) 28 3.4 SB_49711| Best HMM Match : SWIM (HMM E-Value=0.068) 28 3.4 SB_20414| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_2130| Best HMM Match : fn2 (HMM E-Value=2.7e-15) 28 4.5 SB_40057| Best HMM Match : zf-B_box (HMM E-Value=1.4e-08) 27 5.9 SB_51402| Best HMM Match : Peptidase_M13_N (HMM E-Value=1.9e-12) 27 5.9 SB_6713| Best HMM Match : Response_reg (HMM E-Value=0.34) 27 7.8 >SB_7038| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 224 Score = 130 bits (314), Expect = 6e-31 Identities = 58/78 (74%), Positives = 69/78 (88%) Frame = +3 Query: 18 EVRMSSLKLQKRLAASVMRCGKKKVWLDPNEINEIANTNSRQNIRKMIKDGLVIKKPVAV 197 +V + +L+LQKRLAAS+++CGKKK+WLDPNE NEIAN NSRQN+RK+IKDGL+IKKP V Sbjct: 26 KVHVGTLRLQKRLAASLLKCGKKKIWLDPNECNEIANANSRQNVRKLIKDGLIIKKPEIV 85 Query: 198 HSRARVRKNTEARRKGRH 251 HSRARVRK EAR KGRH Sbjct: 86 HSRARVRKADEARSKGRH 103 Score = 92.3 bits (219), Expect = 2e-19 Identities = 43/75 (57%), Positives = 49/75 (65%) Frame = +2 Query: 239 KGSSLCFGKRRGTANARMPQKELWXXXXXXXXXXXXXXXTAKKIDRHLYHSLYMKAKGNV 418 KG GKR+GTANARMPQK +W AKKID H+YHSLYMK+KGNV Sbjct: 100 KGRHSGHGKRKGTANARMPQKTIWIRRMRVLRRLLRKYREAKKIDNHMYHSLYMKSKGNV 159 Query: 419 FXNXXVLMEYIHRKE 463 F N VLMEYIH+K+ Sbjct: 160 FKNKRVLMEYIHKKK 174 >SB_1215| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1033 Score = 28.7 bits (61), Expect = 2.6 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = -2 Query: 327 TLCLCTHSSFCGIRALAVPLLLPKHSDDPFYVPLCFCGHG 208 TLC+ H S C L + L + HS + LC GHG Sbjct: 408 TLCIGGHGSAC----LTITLCIGGHSSACLTITLCIGGHG 443 >SB_20469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 545 Score = 28.3 bits (60), Expect = 3.4 Identities = 15/47 (31%), Positives = 29/47 (61%), Gaps = 1/47 (2%) Frame = +3 Query: 153 KMIKD-GLVIKKPVAVHSRARVRKNTEARRKGRHCALVREEVLPMRV 290 K++++ GL+ + V RA + + +E R+K R CA + + LP+R+ Sbjct: 449 KLLQELGLLRDEAYRVEDRAALAQVSELRKKLRECAPLDKSGLPLRL 495 >SB_50641| Best HMM Match : Rad21_Rec8_N (HMM E-Value=0) Length = 816 Score = 28.3 bits (60), Expect = 3.4 Identities = 26/78 (33%), Positives = 40/78 (51%), Gaps = 1/78 (1%) Frame = +3 Query: 60 ASVMRCGKKKVWLDP-NEINEIANTNSRQNIRKMIKDGLVIKKPVAVHSRARVRKNTEAR 236 A+V G ++ +P EINE ANT + I + +G V+ +PV V V+K +R Sbjct: 507 AAVDELGLEEALQEPVPEINETANTTNELTIVQNEMEGFVL-EPVEV-----VQKGKRSR 560 Query: 237 RKGRHCALVREEVLPMRV 290 RK R + E++L V Sbjct: 561 RK-RKLIVDEEKILSTEV 577 >SB_49711| Best HMM Match : SWIM (HMM E-Value=0.068) Length = 245 Score = 28.3 bits (60), Expect = 3.4 Identities = 15/47 (31%), Positives = 29/47 (61%), Gaps = 1/47 (2%) Frame = +3 Query: 153 KMIKD-GLVIKKPVAVHSRARVRKNTEARRKGRHCALVREEVLPMRV 290 K++++ GL+ + V RA + + +E R+K R CA + + LP+R+ Sbjct: 143 KLLQELGLLRDEAYRVEDRAALAQVSELRKKLRECAPLDKSGLPLRL 189 >SB_20414| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 358 Score = 28.3 bits (60), Expect = 3.4 Identities = 16/35 (45%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = -3 Query: 380 DACQSSWQFCTSGAIFLEPF-VFVPIVPSVAYAHW 279 D + S Q C FLEP VF P+ PS A+AH+ Sbjct: 192 DIVEKSQQACREHEAFLEPMGVFSPLPPS-AHAHF 225 >SB_2130| Best HMM Match : fn2 (HMM E-Value=2.7e-15) Length = 430 Score = 27.9 bits (59), Expect = 4.5 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 2/48 (4%) Frame = +3 Query: 132 NSRQNIRKMIKDGLVIKK--PVAVHSRARVRKNTEARRKGRHCALVRE 269 +S NIRK IKDG K P S +VRK + RR + + V++ Sbjct: 95 SSNTNIRKRIKDGDASKSNVPQRTTSHDQVRKVSGQRRHSTYTSQVKK 142 >SB_40057| Best HMM Match : zf-B_box (HMM E-Value=1.4e-08) Length = 584 Score = 27.5 bits (58), Expect = 5.9 Identities = 13/27 (48%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = -1 Query: 85 FLPHRITEAASLFCSL-RELILTSCRI 8 + PH I E +LFCS+ ELI C I Sbjct: 154 YCPHHIGERLALFCSICDELICRECAI 180 >SB_51402| Best HMM Match : Peptidase_M13_N (HMM E-Value=1.9e-12) Length = 1206 Score = 27.5 bits (58), Expect = 5.9 Identities = 12/27 (44%), Positives = 16/27 (59%) Frame = -3 Query: 395 RVSGIDACQSSWQFCTSGAIFLEPFVF 315 RV+G+ S WQ CT+ A L+ VF Sbjct: 493 RVAGVKKSPSRWQQCTNAANNLDGLVF 519 >SB_6713| Best HMM Match : Response_reg (HMM E-Value=0.34) Length = 225 Score = 27.1 bits (57), Expect = 7.8 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -2 Query: 282 LAVPLLLPKHSDDPFYVPLCFCGHGRGSGL 193 +AV P+ +D+P +VPL G RGS L Sbjct: 191 IAVVKQCPRGTDEPSFVPLMKTGFDRGSYL 220 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,931,588 Number of Sequences: 59808 Number of extensions: 348939 Number of successful extensions: 860 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 824 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 858 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 982083920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -