BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0541 (589 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g07050.1 68416.m00837 GTP-binding family protein contains Pfa... 94 5e-20 At1g52980.1 68414.m05995 GTP-binding family protein contains Pfa... 69 2e-12 At4g02790.1 68417.m00379 GTP-binding family protein contains Pfa... 56 2e-08 At1g08410.1 68414.m00930 GTP-binding family protein contains Pfa... 55 4e-08 At2g27200.1 68415.m03269 GTP-binding family protein contains Pfa... 54 7e-08 At2g41670.1 68415.m05148 GTP-binding family protein contains Pfa... 45 4e-05 At5g11480.1 68418.m01340 expressed protein 38 0.004 At5g58370.2 68418.m07309 expressed protein 38 0.007 At5g58370.1 68418.m07308 expressed protein 38 0.007 At3g12080.1 68416.m01504 GTP-binding family protein contains Pfa... 34 0.081 At1g78010.1 68414.m09091 tRNA modification GTPase, putative simi... 34 0.081 At2g22870.1 68415.m02715 expressed protein 33 0.19 At5g39960.1 68418.m04846 GTP-binding family protein contains Pfa... 32 0.33 At1g50920.1 68414.m05725 GTP-binding protein-related similar to ... 29 1.7 At3g57180.1 68416.m06366 expressed protein 29 2.3 At1g80770.1 68414.m09476 expressed protein 29 2.3 At4g38790.1 68417.m05492 ER lumen protein retaining receptor fam... 29 3.0 At3g05630.1 68416.m00626 phospholipase D, putative (PLDP2) ident... 29 3.0 At1g56710.1 68414.m06522 glycoside hydrolase family 28 protein /... 28 4.0 At1g10300.1 68414.m01160 GTP-binding protein-related contains si... 28 5.3 At3g60020.1 68416.m06702 E3 ubiquitin ligase SCF complex subunit... 27 7.0 At2g36760.1 68415.m04509 UDP-glucoronosyl/UDP-glucosyl transfera... 27 7.0 At1g76580.1 68414.m08911 SPL1-Related3 protein (SPL1R3) identica... 27 9.3 >At3g07050.1 68416.m00837 GTP-binding family protein contains Pfam domain, PF01926: GTPase of unknown function Length = 582 Score = 94.3 bits (224), Expect = 5e-20 Identities = 41/82 (50%), Positives = 58/82 (70%) Frame = +2 Query: 11 PNVGKSSIINSLNRSKACNVGSTPGVTKQMQTVQLDSKIKILDSPGIVFQSGPESDSTVA 190 PNVGKSS+INSL R+ NVG+TPG+T+ +Q V LD +K+LD PG+V +D+++A Sbjct: 262 PNVGKSSLINSLKRAHVVNVGATPGLTRSLQEVHLDKNVKLLDCPGVVMLKSSGNDASIA 321 Query: 191 LKNAIRVGSLKDPVTPATAILR 256 L+N R+ L DPV+P IL+ Sbjct: 322 LRNCKRIEKLDDPVSPVKEILK 343 Score = 62.1 bits (144), Expect = 3e-10 Identities = 27/60 (45%), Positives = 39/60 (65%) Frame = +1 Query: 265 KQTLQDLYRIPDFSTPQEFFAQLAQRMGRFKKGGVPDQEAASRILLNDWNIGXVRYFTEP 444 K L LY+IP F +F ++A G+ KKGG+ D +AA+RI+L+DWN G + Y+T P Sbjct: 347 KDMLVTLYKIPSFEAVDDFLYKVATVRGKLKKGGLVDIDAAARIVLHDWNEGKIPYYTMP 406 >At1g52980.1 68414.m05995 GTP-binding family protein contains Pfam domain, PF01926: GTPase of unknown function Length = 576 Score = 69.3 bits (162), Expect = 2e-12 Identities = 33/82 (40%), Positives = 50/82 (60%) Frame = +2 Query: 11 PNVGKSSIINSLNRSKACNVGSTPGVTKQMQTVQLDSKIKILDSPGIVFQSGPESDSTVA 190 PNVGKSS+IN+L C V PG TK Q + L +I ++D PG+V+QS ++++ + Sbjct: 318 PNVGKSSVINTLRTKNVCKVAPIPGETKVWQYITLTKRIFLIDCPGVVYQS-RDTETDIV 376 Query: 191 LKNAIRVGSLKDPVTPATAILR 256 LK +RV +L+D +LR Sbjct: 377 LKGVVRVTNLEDASEHIGEVLR 398 Score = 54.0 bits (124), Expect = 7e-08 Identities = 22/63 (34%), Positives = 35/63 (55%) Frame = +1 Query: 256 RANKQTLQDLYRIPDFSTPQEFFAQLAQRMGRFKKGGVPDQEAASRILLNDWNIGXVRYF 435 R K+ LQ Y+I D+ +F QL + G+ KGG PD ++++L+DW G + +F Sbjct: 399 RVKKEHLQRAYKIKDWEDDHDFLLQLCKSSGKLLKGGEPDLMTGAKMILHDWQRGRIPFF 458 Query: 436 TEP 444 P Sbjct: 459 VPP 461 >At4g02790.1 68417.m00379 GTP-binding family protein contains Pfam domain, PF01926: GTPase of unknown function Length = 372 Score = 55.6 bits (128), Expect = 2e-08 Identities = 29/65 (44%), Positives = 40/65 (61%) Frame = +2 Query: 11 PNVGKSSIINSLNRSKACNVGSTPGVTKQMQTVQLDSKIKILDSPGIVFQSGPESDSTVA 190 PNVGKSS+IN L + K C PGVT++M+ V+L + +LDSPG++ D A Sbjct: 222 PNVGKSSLINRLLKRKICAAAPRPGVTREMKWVKLGKDLDLLDSPGMLPMR--IDDQAAA 279 Query: 191 LKNAI 205 +K AI Sbjct: 280 IKLAI 284 >At1g08410.1 68414.m00930 GTP-binding family protein contains Pfam domain, PF01926: GTPase of unknown function Length = 589 Score = 54.8 bits (126), Expect = 4e-08 Identities = 26/51 (50%), Positives = 33/51 (64%) Frame = +2 Query: 11 PNVGKSSIINSLNRSKACNVGSTPGVTKQMQTVQLDSKIKILDSPGIVFQS 163 PNVGKSS IN+L K V STPG TK QT+ + ++ + D PG+VF S Sbjct: 317 PNVGKSSTINALVGQKRTGVTSTPGKTKHFQTLIISDELMLCDCPGLVFPS 367 >At2g27200.1 68415.m03269 GTP-binding family protein contains Pfam domain, PF01926: GTPase of unknown function Length = 537 Score = 54.0 bits (124), Expect = 7e-08 Identities = 26/51 (50%), Positives = 32/51 (62%) Frame = +2 Query: 11 PNVGKSSIINSLNRSKACNVGSTPGVTKQMQTVQLDSKIKILDSPGIVFQS 163 PNVGKSS IN+L K V STPG TK QT+ + + + D PG+VF S Sbjct: 313 PNVGKSSTINALVGQKRTGVTSTPGKTKHFQTLIISEDLMLCDCPGLVFPS 363 >At2g41670.1 68415.m05148 GTP-binding family protein contains Pfam domain, PF01926: GTPase of unknown function Length = 386 Score = 44.8 bits (101), Expect = 4e-05 Identities = 34/87 (39%), Positives = 48/87 (55%), Gaps = 13/87 (14%) Frame = +2 Query: 11 PNVGKSSIINSLN-----------RSKACNVGSTPGVTKQMQTVQLDSK--IKILDSPGI 151 PNVGKS++INS++ R K VG PGVT+ + ++ + I +LDSPG+ Sbjct: 145 PNVGKSALINSIHQIAAARFPVQERLKRATVGPLPGVTQDIAGFKIAHRPSIYVLDSPGV 204 Query: 152 VFQSGPESDSTVALKNAIRVGSLKDPV 232 + S P D LK A+ GS+KD V Sbjct: 205 LVPSIP--DIETGLKLALS-GSVKDSV 228 >At5g11480.1 68418.m01340 expressed protein Length = 318 Score = 38.3 bits (85), Expect = 0.004 Identities = 21/53 (39%), Positives = 32/53 (60%), Gaps = 1/53 (1%) Frame = +2 Query: 14 NVGKSSIINSLNRSKACNVGS-TPGVTKQMQTVQLDSKIKILDSPGIVFQSGP 169 NVGKSS++NSL R K + S PG T+ + +++ K ++D PG + S P Sbjct: 145 NVGKSSLLNSLVRRKRLALTSKKPGKTQCINHFRINDKWYLVDLPGYGYASAP 197 >At5g58370.2 68418.m07309 expressed protein Length = 465 Score = 37.5 bits (83), Expect = 0.007 Identities = 18/49 (36%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = +2 Query: 14 NVGKSSIINSLNRS-KACNVGSTPGVTKQMQTVQLDSKIKILDSPGIVF 157 NVGKSS++N+L R PG+T+ + L K++++D PG F Sbjct: 298 NVGKSSLLNALTRQWGVVRTSDKPGLTQTINFFGLGPKVRLVDLPGYGF 346 >At5g58370.1 68418.m07308 expressed protein Length = 446 Score = 37.5 bits (83), Expect = 0.007 Identities = 18/49 (36%), Positives = 28/49 (57%), Gaps = 1/49 (2%) Frame = +2 Query: 14 NVGKSSIINSLNRS-KACNVGSTPGVTKQMQTVQLDSKIKILDSPGIVF 157 NVGKSS++N+L R PG+T+ + L K++++D PG F Sbjct: 298 NVGKSSLLNALTRQWGVVRTSDKPGLTQTINFFGLGPKVRLVDLPGYGF 346 >At3g12080.1 68416.m01504 GTP-binding family protein contains Pfam domain, PF01926: GTPase of unknown function Length = 663 Score = 33.9 bits (74), Expect = 0.081 Identities = 28/100 (28%), Positives = 45/100 (45%), Gaps = 9/100 (9%) Frame = +2 Query: 11 PNVGKSSIINSLNRSKACNVGSTPGVTKQMQTVQL----DSKIKILDSPGI-----VFQS 163 PNVGKSSI+N+L R V G T+ + K +++D+ GI V S Sbjct: 377 PNVGKSSILNALVREDRTIVSPVSGTTRDAIDAEFTGPDGEKFRLIDTAGIRKKSSVASS 436 Query: 164 GPESDSTVALKNAIRVGSLKDPVTPATAILRGLTSKPYKI 283 G +++ +++ A R D V + +T + KI Sbjct: 437 GSTTEA-MSVNRAFRAIRRSDVVALVIEAMACITEQDLKI 475 Score = 31.5 bits (68), Expect = 0.43 Identities = 23/89 (25%), Positives = 40/89 (44%), Gaps = 3/89 (3%) Frame = +2 Query: 11 PNVGKSSIINSLNRSKACNVGSTPGVTKQM---QTVQLDSKIKILDSPGIVFQSGPESDS 181 PNVGKS++ N L V PGVT+ ++ D + ++D+ G++ S S Sbjct: 167 PNVGKSALFNRLVGENRAIVVDEPGVTRDRLYGRSYWGDQEFVVVDTGGVMTVSKSPSGV 226 Query: 182 TVALKNAIRVGSLKDPVTPATAILRGLTS 268 L + +G P++ A + + S Sbjct: 227 MEELNVSTTIGMEGIPLSSREAAIARMPS 255 >At1g78010.1 68414.m09091 tRNA modification GTPase, putative similar to tRNA modification GTPase trmE [strain PCC 7120, Anabaena sp.] SWISS-PROT:Q8YN91 Length = 560 Score = 33.9 bits (74), Expect = 0.081 Identities = 22/100 (22%), Positives = 49/100 (49%), Gaps = 3/100 (3%) Frame = +2 Query: 11 PNVGKSSIINSLNRSKACNVGSTPGVTKQMQTVQLDSK---IKILDSPGIVFQSGPESDS 181 PNVGKSS++N+ ++S+ V G T+ + + + I +LD+ GI + + Sbjct: 326 PNVGKSSLLNAWSKSERAIVTEVAGTTRDVVEANVTVRGVPITLLDTAGI--RETNDIVE 383 Query: 182 TVALKNAIRVGSLKDPVTPATAILRGLTSKPYKICIEYQT 301 + ++ + + D + A + + G T + ++ + Q+ Sbjct: 384 KIGVERSETAAKVADVIIMAVSAVEGWTEEDTELLRKIQS 423 >At2g22870.1 68415.m02715 expressed protein Length = 300 Score = 32.7 bits (71), Expect = 0.19 Identities = 21/58 (36%), Positives = 30/58 (51%), Gaps = 1/58 (1%) Frame = +2 Query: 14 NVGKSSIINSLNRSKACNVGS-TPGVTKQMQTVQLDSKIKILDSPGIVFQSGPESDST 184 NVGKSS+IN L R K + S PG T+ + ++ I+D PG F ++ T Sbjct: 130 NVGKSSLINCLVRKKEVALTSKKPGKTQLINHFLVNKSWYIVDLPGYGFAKVSDAAKT 187 >At5g39960.1 68418.m04846 GTP-binding family protein contains Pfam domain, PF01926: GTPase of unknown function Length = 616 Score = 31.9 bits (69), Expect = 0.33 Identities = 14/36 (38%), Positives = 22/36 (61%) Frame = +2 Query: 11 PNVGKSSIINSLNRSKACNVGSTPGVTKQMQTVQLD 118 PNVGKS+++N+L + VG G+T+ VQ + Sbjct: 321 PNVGKSTLLNALLEEERVLVGPEAGLTRDAVRVQFE 356 >At1g50920.1 68414.m05725 GTP-binding protein-related similar to GTP-binding protein SP:Q99ME9 from [Mus musculus] Length = 671 Score = 29.5 bits (63), Expect = 1.7 Identities = 18/51 (35%), Positives = 28/51 (54%), Gaps = 3/51 (5%) Frame = +2 Query: 11 PNVGKSSIINSLNRSKACNVGSTPGVTKQMQTVQLDSK---IKILDSPGIV 154 PNVGKSS +N + R+ +V TK + D K +++D+PGI+ Sbjct: 177 PNVGKSSFMNKVTRADV-DVQPYAFTTKSLFVGHTDYKYLRYQVIDTPGIL 226 >At3g57180.1 68416.m06366 expressed protein Length = 644 Score = 29.1 bits (62), Expect = 2.3 Identities = 17/54 (31%), Positives = 29/54 (53%), Gaps = 7/54 (12%) Frame = +2 Query: 14 NVGKSSIINSLNRSKACNV-----GSTPGVTKQMQTVQ--LDSKIKILDSPGIV 154 N GKS++IN+L++ V PG T + + L +K K+ D+PG++ Sbjct: 386 NAGKSTLINALSKKDGAKVTRLTEAPVPGTTLGILKIGGILSAKAKMYDTPGLL 439 >At1g80770.1 68414.m09476 expressed protein Length = 451 Score = 29.1 bits (62), Expect = 2.3 Identities = 18/68 (26%), Positives = 33/68 (48%), Gaps = 2/68 (2%) Frame = +2 Query: 8 SPNVGKSSIINSLNRSK--ACNVGSTPGVTKQMQTVQLDSKIKILDSPGIVFQSGPESDS 181 +PNVGKSS++ L+ K CN T V + ++ D+PG++ + + ++ Sbjct: 261 APNVGKSSLVRILSTGKPEICNYPFTTRGILMGHIVLNYQRFQVTDTPGLLRRCDEDRNN 320 Query: 182 TVALKNAI 205 L A+ Sbjct: 321 LEKLTLAV 328 >At4g38790.1 68417.m05492 ER lumen protein retaining receptor family protein similar to SP|P35402 ER lumen protein retaining receptor (HDEL receptor) {Arabidopsis thaliana}; contains Pfam profile PF00810: ER lumen protein retaining receptor Length = 273 Score = 28.7 bits (61), Expect = 3.0 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = -2 Query: 147 PGLSRILIFESSWTVCICLVTPGVLPTLQALDRFKLL 37 P S +I SW +C+ L VLP L+ + K++ Sbjct: 155 PSTSHNIINRISWALCVYLEAVSVLPQLRVMQNTKIV 191 >At3g05630.1 68416.m00626 phospholipase D, putative (PLDP2) identical to SP|Q9M9W8 Phospholipase D p2 (EC 3.1.4.4) (AtPLDp2) (Phospholipase D2 PHOX and PX containing domain) (Phospholipase D zeta 2) (PLDzeta2) {Arabidopsis thaliana}; similar to phospholipase D GB:BAA24577 from [Rattus norvegicus]; contains Pfam profile: PF00614 phospholipase D, PF00169 PH domain, PF00787 PX domain Length = 1046 Score = 28.7 bits (61), Expect = 3.0 Identities = 16/39 (41%), Positives = 21/39 (53%) Frame = -2 Query: 123 FESSWTVCICLVTPGVLPTLQALDRFKLLIIELFPTFGL 7 F +SWT ++ PG L L+ KLL I +F T GL Sbjct: 248 FGTSWTKVWAVLKPGFLALLEDPFSGKLLDIMVFDTLGL 286 >At1g56710.1 68414.m06522 glycoside hydrolase family 28 protein / polygalacturonase (pectinase) family protein similar to polygalacturonase PG1 GI:5669846, PG2 GI:5669848 from (Glycine max); contains PF00295: Glycosyl hydrolases family 28 (polygalacturonases) Length = 434 Score = 28.3 bits (60), Expect = 4.0 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = +1 Query: 136 GQSWYSIPIRPGE*FNGSTQ 195 GQ W+++P +P + NG+TQ Sbjct: 154 GQKWWNLPCKPHKGLNGTTQ 173 >At1g10300.1 68414.m01160 GTP-binding protein-related contains similarity to nucleolar GTP-binding protein 1 SP: Q9BZE4 from [Homo sapiens]; Length = 687 Score = 27.9 bits (59), Expect = 5.3 Identities = 17/51 (33%), Positives = 27/51 (52%), Gaps = 3/51 (5%) Frame = +2 Query: 11 PNVGKSSIINSLNRSKACNVGSTPGVTKQMQTVQLDSK---IKILDSPGIV 154 PNVGKSS +N + R+ V TK + D K +++D+PG++ Sbjct: 206 PNVGKSSFMNKVTRADVA-VQPYAFTTKSLFLGHTDYKCLRYQVIDTPGLL 255 >At3g60020.1 68416.m06702 E3 ubiquitin ligase SCF complex subunit SKP1/ASK1 (At5), putative E3 ubiquitin ligase; similar to Skp1 GI:4959710 from [Medicago sativa] Length = 153 Score = 27.5 bits (58), Expect = 7.0 Identities = 23/79 (29%), Positives = 35/79 (44%) Frame = +2 Query: 113 LDSKIKILDSPGIVFQSGPESDSTVALKNAIRVGSLKDPVTPATAILRGLTSKPYKICIE 292 + +KI + S G F E D VA K+ ++D LR +TSK KI I+ Sbjct: 1 MSTKIMLKSSDGKSF----EIDEDVARKSIAINHMVEDGCATDVIPLRNVTSKILKIVID 56 Query: 293 YQTSVHLRNSLRN*HNEWE 349 Y H+++ EW+ Sbjct: 57 Y-CEKHVKSKEEEDLKEWD 74 >At2g36760.1 68415.m04509 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 496 Score = 27.5 bits (58), Expect = 7.0 Identities = 14/48 (29%), Positives = 23/48 (47%) Frame = -2 Query: 480 RPTLXISVXCLGRLREIAYXTNVPVIEQYSRSCFLVWXSTFFEPSHSL 337 +P+ IS CL +IA N+P I + SCF + +H++ Sbjct: 123 KPSCLISDFCLPYTSKIAKRFNIPKIVFHGVSCFCLLSMHILHRNHNI 170 >At1g76580.1 68414.m08911 SPL1-Related3 protein (SPL1R3) identical to cDNA partial mRNA for SPL1-Related3 protein (SPL1R3 gene) GI:6006428 Length = 488 Score = 27.1 bits (57), Expect = 9.3 Identities = 24/91 (26%), Positives = 44/91 (48%), Gaps = 10/91 (10%) Frame = +2 Query: 26 SSIINSLNRSKACNVGSTPGVTKQMQTVQLDSKIKILDSP----------GIVFQSGPES 175 ++++ + R++A GS PGV ++ Q +Q+ +KIK L P GI+ + PE Sbjct: 8 TALVCAQGRNEATTNGS-PGVPQREQLLQILNKIKALPLPMNLTSKLNNIGILARKNPEQ 66 Query: 176 DSTVALKNAIRVGSLKDPVTPATAILRGLTS 268 S + +N++ S + A+ L S Sbjct: 67 PSPMNPQNSMNGASSPSTMDLLAALSASLGS 97 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,831,649 Number of Sequences: 28952 Number of extensions: 231693 Number of successful extensions: 601 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 580 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 595 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1161268208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -