BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0535 (457 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC21H7.02 |taf10||transcription factor TFIID complex subunit T... 44 1e-05 SPCC63.06 |||human WDR89 family WD repeat protein|Schizosaccharo... 25 7.3 >SPBC21H7.02 |taf10||transcription factor TFIID complex subunit Taf10 |Schizosaccharomyces pombe|chr 2|||Manual Length = 215 Score = 43.6 bits (98), Expect = 1e-05 Identities = 17/30 (56%), Positives = 25/30 (83%) Frame = +3 Query: 258 YYLNLTGFESQDPRLVRLIALASQKFLSDI 347 YYL+L+GF+ DPRL +L+ L +QKF+SD+ Sbjct: 114 YYLSLSGFKCVDPRLKKLLGLTAQKFISDV 143 Score = 25.0 bits (52), Expect = 5.5 Identities = 9/17 (52%), Positives = 14/17 (82%) Frame = +1 Query: 196 LGDFLLQLENYNPSIPD 246 L +FL Q+++Y+P IPD Sbjct: 93 LENFLAQMDDYSPLIPD 109 >SPCC63.06 |||human WDR89 family WD repeat protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 331 Score = 24.6 bits (51), Expect = 7.3 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -1 Query: 376 SCSAXVHHITMSDKNFC 326 SCS ++ ++ SDK FC Sbjct: 250 SCSYVINEVSTSDKQFC 266 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,599,722 Number of Sequences: 5004 Number of extensions: 27757 Number of successful extensions: 68 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 64 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 68 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 170285640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -