BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0535 (457 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ435337-1|ABD92652.1| 135|Apis mellifera OBP20 protein. 22 2.7 >DQ435337-1|ABD92652.1| 135|Apis mellifera OBP20 protein. Length = 135 Score = 22.2 bits (45), Expect = 2.7 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = -3 Query: 332 FL*CQCDQSDKSRIL*LESG*IQIICTTESGMD 234 F C C + L ++ +Q IC TESG+D Sbjct: 8 FAFCICVNAMTIEELKIQLHDVQEICKTESGID 40 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 105,716 Number of Sequences: 438 Number of extensions: 1714 Number of successful extensions: 9 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 12066642 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -