BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0532 (559 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ855501-1|ABH88188.1| 146|Tribolium castaneum chemosensory pro... 22 3.1 DQ855504-1|ABH88191.1| 124|Tribolium castaneum chemosensory pro... 21 5.4 U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 21 7.2 AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 21 7.2 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 21 9.5 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 21 9.5 AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical pro... 21 9.5 >DQ855501-1|ABH88188.1| 146|Tribolium castaneum chemosensory protein 15 protein. Length = 146 Score = 22.2 bits (45), Expect = 3.1 Identities = 12/55 (21%), Positives = 27/55 (49%) Frame = +3 Query: 9 GIMKTFIVFVVCVVLAQALTDEQKENLKKHRADCLSETKADEQLVNKLKTGDFKT 173 G + T++ V ++L + T + + + ++ DC+ + + KLK G +T Sbjct: 11 GALLTYVSSVEYLILREIDTILKNDQMTRNYLDCVLDKGKCTKEAEKLKKGITET 65 >DQ855504-1|ABH88191.1| 124|Tribolium castaneum chemosensory protein 18 protein. Length = 124 Score = 21.4 bits (43), Expect = 5.4 Identities = 10/32 (31%), Positives = 14/32 (43%) Frame = +3 Query: 162 DFKTENEPLKKYALCMLIKSQLMTKDGKFKKT 257 D + LK Y C+L K + + K K T Sbjct: 30 DILSNERLLKNYVNCLLDKGRCTPEGKKLKST 61 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 21.0 bits (42), Expect = 7.2 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +1 Query: 343 PSPNSLELCEMLPRERPEA 399 P N E + PRERP A Sbjct: 302 PGQNPGEKTNIAPRERPRA 320 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 21.0 bits (42), Expect = 7.2 Identities = 11/34 (32%), Positives = 14/34 (41%) Frame = +2 Query: 344 PHQTAWNYVKCYHEKDPKHALFL*THNPTQPFHT 445 PH+ Y +C H K + A P FHT Sbjct: 484 PHELCDKYYRCVHGKPTEFAC-----RPGTVFHT 512 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 20.6 bits (41), Expect = 9.5 Identities = 8/24 (33%), Positives = 16/24 (66%) Frame = +3 Query: 48 VLAQALTDEQKENLKKHRADCLSE 119 ++ Q + DE++++ KH A L+E Sbjct: 121 IVPQNVLDEEEKSSTKHYAALLTE 144 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 20.6 bits (41), Expect = 9.5 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -1 Query: 415 LQEKSVLRVFLVVAFHI 365 L+EK +++FL FHI Sbjct: 484 LREKPDVKIFLPFRFHI 500 >AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical protein protein. Length = 205 Score = 20.6 bits (41), Expect = 9.5 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 125 FRLGETVGSVFLQVLLLLICE 63 ++L VGS L LLIC+ Sbjct: 3 YQLTACVGSAIAGFLFLLICD 23 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 125,742 Number of Sequences: 336 Number of extensions: 2607 Number of successful extensions: 7 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 13681771 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -