BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0530 (612 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g60890.1 68416.m06812 hypothetical protein 30 1.1 At5g62240.1 68418.m07815 expressed protein various predicted pro... 29 2.4 At3g42530.1 68416.m04410 Ulp1 protease family similar to At5g281... 29 3.2 At1g22360.1 68414.m02797 UDP-glucoronosyl/UDP-glucosyl transfera... 29 3.2 At4g03970.1 68417.m00561 Ulp1 protease family protein contains P... 28 5.6 At1g66345.1 68414.m07535 pentatricopeptide (PPR) repeat-containi... 28 5.6 At5g53520.1 68418.m06651 oligopeptide transporter OPT family pro... 27 7.4 At2g10350.1 68415.m01087 Ulp1 protease family protein similar to... 27 7.4 At1g70340.1 68414.m08092 expressed protein 27 7.4 At1g65930.1 68414.m07481 isocitrate dehydrogenase, putative / NA... 27 7.4 At1g44880.1 68414.m05142 Ulp1 protease family protein similar to... 27 7.4 At3g46240.1 68416.m05005 protein kinase-related similar to light... 27 9.8 >At3g60890.1 68416.m06812 hypothetical protein Length = 105 Score = 30.3 bits (65), Expect = 1.1 Identities = 18/53 (33%), Positives = 25/53 (47%), Gaps = 2/53 (3%) Frame = +1 Query: 178 KKNSFRASSMFSHSKEVSRENKY--SKARLPHFERQLLLDLSKPKYGPPKYTL 330 K+ R +F ++ + REN+ KA L H E L L PKY P +L Sbjct: 51 KEMEMRNLKLFVENQSIIRENEALKKKALLLHHENNALFALLHPKYSPVSTSL 103 >At5g62240.1 68418.m07815 expressed protein various predicted proteins, Arabidopsis thaliana; expression supported by MPSS Length = 366 Score = 29.1 bits (62), Expect = 2.4 Identities = 24/85 (28%), Positives = 41/85 (48%), Gaps = 4/85 (4%) Frame = +2 Query: 83 FNKHVTLVFRTIIL*YNINPHLQPLKL-RMSSLKKILLEPRACLVTAKR---FRGKINIQ 250 F ++V V + + + N Q K+ +SS K+ + L TA+R R K+N Q Sbjct: 164 FGENVAPVLVSKLQNQDTNRQKQEAKVAHVSSRAKLTVPKEPNLRTAERSERHRSKVNTQ 223 Query: 251 RQGCLISNGSYYLIYQNLNMVRPST 325 R+ SN ++ +N+N+ ST Sbjct: 224 REQIATSNSKRHIRNKNINLEPVST 248 >At3g42530.1 68416.m04410 Ulp1 protease family similar to At5g28170, At1g35110, At1g44880, At4g19320, At5g36020, At4g03970, At3g43010, At2g10350; contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain Length = 889 Score = 28.7 bits (61), Expect = 3.2 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = -1 Query: 234 PRNLFAVTKHARGSKRIFFNDDILSF 157 P LFA+ ++ RG I+ DILSF Sbjct: 18 PNRLFAIDQYPRGRLNIYSRPDILSF 43 >At1g22360.1 68414.m02797 UDP-glucoronosyl/UDP-glucosyl transferase family protein contains Pfam profile: PF00201 UDP-glucoronosyl and UDP-glucosyl transferase Length = 481 Score = 28.7 bits (61), Expect = 3.2 Identities = 16/59 (27%), Positives = 28/59 (47%), Gaps = 4/59 (6%) Frame = +1 Query: 313 PPKYTLPDFLLCDRGEKKNKTEIDNPFERILARE--CLEWFNTS--KMIVFLHVNPITM 477 PP Y++ L ++ E +EI + E CL+W NT +V+++ IT+ Sbjct: 248 PPVYSIGPLHLLEKQESGEYSEIGRTGSNLWREETECLDWLNTKARNSVVYVNFGSITV 306 >At4g03970.1 68417.m00561 Ulp1 protease family protein contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain; similar to At5g28170, At1g35110, At1g44880, At3g42530, At4g19320, At5g36020, At3g43010, At2g10350 Length = 1043 Score = 27.9 bits (59), Expect = 5.6 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = -1 Query: 234 PRNLFAVTKHARGSKRIFFNDDILSF 157 P LFA ++ RG I+ DILSF Sbjct: 18 PNRLFATDQYPRGKLNIYSRPDILSF 43 >At1g66345.1 68414.m07535 pentatricopeptide (PPR) repeat-containing protein low similarity to fertility restorer [Petunia x hybrida] GI:22128587; contains Pfam profile PF01535: PPR repeat Length = 544 Score = 27.9 bits (59), Expect = 5.6 Identities = 19/74 (25%), Positives = 33/74 (44%) Frame = +1 Query: 340 LLCDRGEKKNKTEIDNPFERILARECLEWFNTSKMIVFLHVNPITMEDKTPVYAALIRIK 519 +LC G K E+ + +RI + CL + +VF + + +E+ + L+ Sbjct: 243 VLCKEGRLK---EVVDLLDRICGKRCLPSVIVNTSLVFRVLEEMRIEESMSLLKRLLMKN 299 Query: 520 MYLRTYGKKIVSLA 561 M + T G IV A Sbjct: 300 MVVDTIGYSIVVYA 313 >At5g53520.1 68418.m06651 oligopeptide transporter OPT family protein similar to SP|P40900 Sexual differentiation process protein isp4 {Schizosaccharomyces pombe}, oligopeptide transporter Opt1p [Candida albicans] GI:2367386; contains Pfam profile PF03169: OPT oligopeptide transporter protein Length = 733 Score = 27.5 bits (58), Expect = 7.4 Identities = 11/31 (35%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 3 RYVMGNWKKIEINS-IIYSNFKNIPVWYLIS 92 R G KK++I++ I+ N+K +P+W+ +S Sbjct: 388 RGAFGKNKKMDIHTKIMKRNYKEVPLWWFLS 418 >At2g10350.1 68415.m01087 Ulp1 protease family protein similar to At5g28170, At1g35110, At1g44880, At3g42530, At4g19320, At5g36020, At4g03970, At3g43010 ; contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain Length = 1110 Score = 27.5 bits (58), Expect = 7.4 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = -1 Query: 234 PRNLFAVTKHARGSKRIFFNDDILSF 157 P LFA ++ RG I+ DILSF Sbjct: 18 PNRLFATDQYPRGRLNIYSRPDILSF 43 >At1g70340.1 68414.m08092 expressed protein Length = 510 Score = 27.5 bits (58), Expect = 7.4 Identities = 15/36 (41%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = +1 Query: 343 LCDRGEKKNKTEIDNPFERIL-ARECLEWFNTSKMI 447 +CDR KKN + +PF+ L A+E + +TSK I Sbjct: 223 VCDRQAKKNNASLFSPFKSSLEAQEDVVPLSTSKKI 258 >At1g65930.1 68414.m07481 isocitrate dehydrogenase, putative / NADP+ isocitrate dehydrogenase, putative strong similarity to isocitrate dehydrogenase SP|Q40345 from [Medicago sativa] Length = 410 Score = 27.5 bits (58), Expect = 7.4 Identities = 15/45 (33%), Positives = 25/45 (55%) Frame = +1 Query: 160 TENVIIKKNSFRASSMFSHSKEVSRENKYSKARLPHFERQLLLDL 294 T+N I+KK R +F E S ++KY A + +E +L+ D+ Sbjct: 211 TKNTILKKYDGRFKDIFQEVYEASWKSKYDAAGI-WYEHRLIDDM 254 >At1g44880.1 68414.m05142 Ulp1 protease family protein similar to At5g28170, At1g35110, At3g42530, At4g19320, At5g36020, At4g03970, At3g43010, At2g10350; contains Pfam profile PF02902: Ulp1 protease family, C-terminal catalytic domain Length = 1038 Score = 27.5 bits (58), Expect = 7.4 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = -1 Query: 234 PRNLFAVTKHARGSKRIFFNDDILSF 157 P LFA ++ RG I+ DILSF Sbjct: 18 PNRLFATDQYPRGRLNIYSRPDILSF 43 >At3g46240.1 68416.m05005 protein kinase-related similar to light repressible receptor protein kinase (GI:1321686) [Arabidopsis thaliana] Length = 441 Score = 27.1 bits (57), Expect = 9.8 Identities = 12/33 (36%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = -2 Query: 395 SKGLSISVLFFFS-PLSQSKKSGNVYLGGPYLG 300 S G+ + + +FS PL S +S N++ GG +G Sbjct: 217 SAGVPVYLAMYFSEPLESSLRSFNIFFGGKQVG 249 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,778,388 Number of Sequences: 28952 Number of extensions: 262171 Number of successful extensions: 714 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 704 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 714 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1226538000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -