BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0527 (484 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_03_1406 + 26343915-26346032 30 0.85 02_04_0470 - 23183925-23184743,23184929-23185153 28 3.4 01_01_0180 + 1533219-1533536,1533658-1533825,1535404-1535475,153... 28 3.4 08_02_0355 - 16162342-16162598,16162748-16162792,16163676-16163685 28 4.5 05_06_0142 + 25968828-25969157,25969283-25969447,25969564-25969884 28 4.5 04_04_0466 + 25433678-25434007,25434118-25434176,25434345-254344... 28 4.5 08_01_0487 + 4272015-4272344 27 6.0 04_01_0100 + 1034057-1034308,1034962-1035078,1035152-1035382,103... 27 6.0 11_02_0070 - 8004397-8004645,8004796-8004961,8005039-8005793 27 7.9 >07_03_1406 + 26343915-26346032 Length = 705 Score = 30.3 bits (65), Expect = 0.85 Identities = 14/29 (48%), Positives = 15/29 (51%) Frame = +2 Query: 17 RPSEPKPTSPARGAPCRPTNEALARRGRH 103 RP P SPA + C P A ARRG H Sbjct: 19 RPRLPPLASPATTSTCAPAPAATARRGSH 47 >02_04_0470 - 23183925-23184743,23184929-23185153 Length = 347 Score = 28.3 bits (60), Expect = 3.4 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +2 Query: 2 GTSLPRPSEPKPTSPARGAPCR 67 GT++P P P P AR PCR Sbjct: 255 GTAVPDPRPPPPPPKARRRPCR 276 >01_01_0180 + 1533219-1533536,1533658-1533825,1535404-1535475, 1536174-1536179,1536228-1536440,1537434-1537700, 1537947-1538267 Length = 454 Score = 28.3 bits (60), Expect = 3.4 Identities = 15/45 (33%), Positives = 22/45 (48%) Frame = +2 Query: 14 PRPSEPKPTSPARGAPCRPTNEALARRGRHGTTVAYIVDDSGSDH 148 P P E +P+SP+ C + RRG + VA + D + DH Sbjct: 6 PPPPEEEPSSPSLRLRCAVQHYEWGRRG-EASLVARLSDANADDH 49 >08_02_0355 - 16162342-16162598,16162748-16162792,16163676-16163685 Length = 103 Score = 27.9 bits (59), Expect = 4.5 Identities = 16/47 (34%), Positives = 22/47 (46%) Frame = +2 Query: 5 TSLPRPSEPKPTSPARGAPCRPTNEALARRGRHGTTVAYIVDDSGSD 145 TS+ R S P P A A CR +E + RR R +D+ +D Sbjct: 21 TSITRRSTPLPVCLALPAGCRRASEWMVRRARQRVGEGVRLDNGLAD 67 >05_06_0142 + 25968828-25969157,25969283-25969447,25969564-25969884 Length = 271 Score = 27.9 bits (59), Expect = 4.5 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = +2 Query: 65 RPTNEALARRGRHGTTVAYIVDDSGS 142 RP+ A RR RHGT VAY+ + S Sbjct: 22 RPSPSAPNRRRRHGTVVAYMEPNPNS 47 >04_04_0466 + 25433678-25434007,25434118-25434176,25434345-25434426, 25435024-25435122,25435750-25435831,25436759-25436823, 25437241-25438308,25438369-25438446,25438550-25438596, 25438734-25438779,25438871-25438950,25439050-25439166, 25439842-25439923,25440156-25440281,25440415-25440489, 25440743-25440868,25441542-25441646 Length = 888 Score = 27.9 bits (59), Expect = 4.5 Identities = 11/23 (47%), Positives = 17/23 (73%), Gaps = 1/23 (4%) Frame = -2 Query: 312 STPKALDSNPYYWKCFTS-LNRN 247 S+P +++ Y+WK FTS LN+N Sbjct: 365 SSPNMKETDEYFWKAFTSVLNQN 387 >08_01_0487 + 4272015-4272344 Length = 109 Score = 27.5 bits (58), Expect = 6.0 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = +2 Query: 26 EPKPTSPARGAPCRPTNEALARRGRHGTTVAYIV 127 E +P GAP RP A R GR G V + V Sbjct: 61 EMRPRGGGGGAPRRPAPPAGPREGRGGVVVVHAV 94 >04_01_0100 + 1034057-1034308,1034962-1035078,1035152-1035382, 1038200-1038455,1038551-1038807,1038978-1039250, 1039617-1039898,1040045-1040165,1040351-1040520, 1040613-1040711 Length = 685 Score = 27.5 bits (58), Expect = 6.0 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +2 Query: 20 PSEPKPTSPARGAPCRPTNEALARR 94 P++P +SPA +P RP+ E L R Sbjct: 13 PADPPDSSPAASSPPRPSPEELVAR 37 >11_02_0070 - 8004397-8004645,8004796-8004961,8005039-8005793 Length = 389 Score = 27.1 bits (57), Expect = 7.9 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = -1 Query: 121 VGDGGSVTTTPRQSLVCWSAGCA 53 VGD G VT + R W+A CA Sbjct: 39 VGDDGGVTDSARAFEAAWAAACA 61 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,303,063 Number of Sequences: 37544 Number of extensions: 197297 Number of successful extensions: 816 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 760 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 812 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 987904180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -