BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0527 (484 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF016672-8|AAB66117.4| 998|Caenorhabditis elegans Jnk interacti... 28 4.1 U40952-2|AAA81737.1| 818|Caenorhabditis elegans Hypothetical pr... 27 7.1 >AF016672-8|AAB66117.4| 998|Caenorhabditis elegans Jnk interacting protein (scaffoldprotein) protein 1 protein. Length = 998 Score = 27.9 bits (59), Expect = 4.1 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +2 Query: 8 SLPRPSEPKPTSPARGAPCRP 70 S P PS P+P SP G P P Sbjct: 279 SAPSPSPPRPLSPVFGQPAPP 299 >U40952-2|AAA81737.1| 818|Caenorhabditis elegans Hypothetical protein C03B1.7 protein. Length = 818 Score = 27.1 bits (57), Expect = 7.1 Identities = 21/70 (30%), Positives = 33/70 (47%), Gaps = 2/70 (2%) Frame = +1 Query: 172 NNDYVSNIQCRIY*CKTSQSYLPHFISI*TSKALPVIWVTV*GFR--CRXYSNRHYMCKC 345 NN+ + + S+ P+F S K P++ V F+ C YSN Y K Sbjct: 688 NNEVFESASEELEMFMNSEGIAPNFHSEFAKKTSPLL-VGNAEFKDFCSKYSNSKYDNKT 746 Query: 346 ISKIRQRYIN 375 ISK+ ++YI+ Sbjct: 747 ISKLVKKYID 756 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,548,928 Number of Sequences: 27780 Number of extensions: 165111 Number of successful extensions: 452 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 429 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 452 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 892829112 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -