BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0522 (453 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 21 4.1 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 4.1 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 4.1 S73225-1|AAB30811.1| 327|Tribolium castaneum protein ( Triboliu... 21 5.4 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 7.1 AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 prot... 21 7.1 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 21.4 bits (43), Expect = 4.1 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = +3 Query: 240 WYSGPREIRRYQKSTELLIRKLPFQRLVRE 329 W+ P E+ + KS L + R+VRE Sbjct: 309 WHETPEEMMEFLKSVFRLDQDQCSHRIVRE 338 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.4 bits (43), Expect = 4.1 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = +3 Query: 240 WYSGPREIRRYQKSTELLIRKLPFQRLVRE 329 W+ P E+ + KS L + R+VRE Sbjct: 542 WHETPEEMMEFLKSVFRLDQDQCSHRIVRE 571 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.4 bits (43), Expect = 4.1 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = +3 Query: 240 WYSGPREIRRYQKSTELLIRKLPFQRLVRE 329 W+ P E+ + KS L + R+VRE Sbjct: 542 WHETPEEMMEFLKSVFRLDQDQCSHRIVRE 571 >S73225-1|AAB30811.1| 327|Tribolium castaneum protein ( Tribolium castaneum homeodomainprotein mRNA, complete cds. ). Length = 327 Score = 21.0 bits (42), Expect = 5.4 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = +1 Query: 118 TKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKP 225 T+ + R S+G ++PR + K K T K+P Sbjct: 197 TRYSDRPSSG-RSPRTRRVKKPGAKQGAPTAEEKRP 231 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 20.6 bits (41), Expect = 7.1 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = +3 Query: 300 KLPFQRLVREIAQDFKTDLRFQSAASELSRRQAEA 404 K F V+E+ + FK SAA SRR +A Sbjct: 1962 KSAFADFVKELHEAFKPKGWLLSAAVSPSRRVVDA 1996 >AY675073-1|AAV74190.1| 533|Tribolium castaneum chitinase 5 protein. Length = 533 Score = 20.6 bits (41), Expect = 7.1 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +3 Query: 210 WSQEATSLSPWYSGPREIRRYQK 278 W+ A S SP Y P + Y+K Sbjct: 220 WAGFADSHSPLYKRPHDQWAYEK 242 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 92,250 Number of Sequences: 336 Number of extensions: 1663 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10301074 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -