BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0518 (488 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_0657 - 4915264-4915386,4915586-4915714,4917773-4917859,491... 29 2.0 02_02_0516 + 11116746-11116998,11117547-11117671,11118363-111188... 28 3.5 >07_01_0657 - 4915264-4915386,4915586-4915714,4917773-4917859, 4918220-4918368,4918498-4918555,4918632-4920614, 4922064-4922123 Length = 862 Score = 29.1 bits (62), Expect = 2.0 Identities = 11/41 (26%), Positives = 22/41 (53%) Frame = +3 Query: 27 GLILAPVLCHVFNTCIDSGIFPTVFKKALVHPIHKNGDKMN 149 G ++ P C V + C+ G+F + L+H +++ D +N Sbjct: 123 GYVITPCSCPVGSDCVCDGLFNLLEDNHLIHNVNQAPDVVN 163 >02_02_0516 + 11116746-11116998,11117547-11117671,11118363-11118855, 11118996-11119201 Length = 358 Score = 28.3 bits (60), Expect = 3.5 Identities = 9/16 (56%), Positives = 11/16 (68%) Frame = -3 Query: 288 PLPDLKPYWFWELCYT 241 P + K YWFW+L YT Sbjct: 311 PCQNRKQYWFWDLSYT 326 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,863,274 Number of Sequences: 37544 Number of extensions: 183915 Number of successful extensions: 312 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 310 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 312 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1011709100 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -