BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0518 (488 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase prot... 24 1.00 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 22 4.0 >AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase protein. Length = 693 Score = 23.8 bits (49), Expect = 1.00 Identities = 6/16 (37%), Positives = 10/16 (62%) Frame = -3 Query: 267 YWFWELCYTFSGNLAV 220 +W W L Y F G++ + Sbjct: 209 HWHWHLVYPFEGDIRI 224 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 21.8 bits (44), Expect = 4.0 Identities = 18/62 (29%), Positives = 27/62 (43%) Frame = +3 Query: 15 IKAAGLILAPVLCHVFNTCIDSGIFPTVFKKALVHPIHKNGDKMNITNYRPISVLSTLSK 194 I A G+I P + VF ++ TVF++ L+ G +T P S L K Sbjct: 634 IMALGMIGEPKILSVFEPYLEGKQQMTVFQRTLM-----VGSLGKLTETNPKLARSVLYK 688 Query: 195 IF 200 I+ Sbjct: 689 IY 690 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 119,657 Number of Sequences: 438 Number of extensions: 2355 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 13421061 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -