BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0513 (466 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 24 3.0 DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 23 4.0 AF515734-1|AAO14865.1| 1325|Anopheles gambiae xanthine dehydroge... 23 4.0 AY391745-1|AAR28995.1| 460|Anopheles gambiae putative GPCR prot... 23 5.3 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 22 9.2 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 23.8 bits (49), Expect = 3.0 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = -2 Query: 357 SYVTVASEASLLCFLCVLSFNFWRICITS*LHRNGNWL 244 SY T+ ++ SL+ F C + + ITS ++ NW+ Sbjct: 2996 SYETIKNKNSLMRFECCIDCSQDASSITSNSYKVTNWI 3033 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 23.4 bits (48), Expect = 4.0 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +2 Query: 167 QAKSQ*YIREVKHQVICVEFEHGNYKSQF 253 +AK+ + R V+H V V+F+ G + QF Sbjct: 243 RAKTCDWCRHVRHAVSYVDFQDGASQLQF 271 >AF515734-1|AAO14865.1| 1325|Anopheles gambiae xanthine dehydrogenase protein. Length = 1325 Score = 23.4 bits (48), Expect = 4.0 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -3 Query: 272 HNYTEMGIGFYSFHVQIQHISLGV 201 H TEMG G ++ +Q+ +LG+ Sbjct: 1024 HGGTEMGQGLHTKMIQVAATALGI 1047 >AY391745-1|AAR28995.1| 460|Anopheles gambiae putative GPCR protein. Length = 460 Score = 23.0 bits (47), Expect = 5.3 Identities = 18/58 (31%), Positives = 24/58 (41%) Frame = -2 Query: 462 FLNFSELVFFHSF*ELXNFLGTLIFAFCVL*VMTVSYVTVASEASLLCFLCVLSFNFW 289 FLNF + + N L L+F L ++ SY A S C+L L F W Sbjct: 40 FLNFYYMPLLVVVGSIGNILSVLVFFNTKLKKLSSSYYLAALGISDTCYLVGL-FVTW 96 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 22.2 bits (45), Expect = 9.2 Identities = 11/26 (42%), Positives = 14/26 (53%) Frame = -1 Query: 421 GTXEFFGHSDFCILCLVSNDSLICNS 344 GT + F + F I C VS L C+S Sbjct: 23 GTGKPFLPTSFLIYCFVSPSCLECSS 48 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 401,395 Number of Sequences: 2352 Number of extensions: 6662 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 40395045 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -