BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0512 (455 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 23 1.2 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 23 2.1 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 21 4.8 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 23.4 bits (48), Expect = 1.2 Identities = 16/53 (30%), Positives = 23/53 (43%), Gaps = 2/53 (3%) Frame = +2 Query: 209 ITVLPRLILYCVCVKYYNPKR--PSVRPALSLPYIYS*INKHHYFILSINYFS 361 I +LP + +YCV V N VR LS ++ Y L ++Y S Sbjct: 785 IPILPMIPVYCVPVPQVNDSTILSPVREKLSSSQPMQPPQQNPYMFLPVSYMS 837 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 22.6 bits (46), Expect = 2.1 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Frame = -3 Query: 222 GNTV--IGRRASRSSFNIKIIECGGLYASLLPANDS 121 G T+ IGR+ S NIKII + L P++DS Sbjct: 217 GGTISGIGRKLKELSPNIKIIAVDPKGSILDPSSDS 252 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 21.4 bits (43), Expect = 4.8 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = -2 Query: 52 SCPRFRLAFSHRPLVP 5 SCP + F+H P P Sbjct: 190 SCPEISVNFAHFPATP 205 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 90,592 Number of Sequences: 438 Number of extensions: 1444 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 12066642 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -