Bombyx BLAST Result against uniref50

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= br--0506
         (467 letters)

Database: uniref50 
           1,657,284 sequences; 575,637,011 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

UniRef50_A5JZK1 Cluster: DHHC zinc finger domain containing prot...    32   7.2  

>UniRef50_A5JZK1 Cluster: DHHC zinc finger domain containing
           protein; n=5; Plasmodium|Rep: DHHC zinc finger domain
           containing protein - Plasmodium vivax
          Length = 287

 Score = 31.9 bits (69), Expect = 7.2
 Identities = 18/62 (29%), Positives = 32/62 (51%), Gaps = 1/62 (1%)
 Frame = -2

Query: 298 ICACRRPY*NVAFSHIYYKHIKHRNVSRLLCFLREFS-LLISGFFYDIKQETFNVFRLNH 122
           IC C + Y N+    I+Y   ++ +++  + +    S LLI+ FFY +K    N  R  +
Sbjct: 185 ICLCMKEYQNITLGSIFYITFEYPHIALYIIYTIPSSLLLINLFFYHLKMILSN--RTTY 242

Query: 121 DD 116
           +D
Sbjct: 243 ED 244


  Database: uniref50
    Posted date:  Oct 5, 2007 11:19 AM
  Number of letters in database: 575,637,011
  Number of sequences in database:  1,657,284
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 414,543,408
Number of Sequences: 1657284
Number of extensions: 7368639
Number of successful extensions: 14821
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 14508
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 14821
length of database: 575,637,011
effective HSP length: 94
effective length of database: 419,852,315
effective search space used: 25610991215
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)