BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0506 (467 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC338.03c |||dubious|Schizosaccharomyces pombe|chr 3|||Manual 26 2.5 SPCC794.04c |||membrane transporter|Schizosaccharomyces pombe|ch... 25 4.4 SPCC18B5.01c |bfr1|hba2, SPCPJ732.04c|brefeldin A efflux transpo... 25 5.8 SPAC3C7.01c ||SPAC732.03c|inositol polyphosphate phosphatase |Sc... 25 5.8 SPAP27G11.15 |slx1||structure-specific endonuclease catalytic su... 25 7.6 >SPCC338.03c |||dubious|Schizosaccharomyces pombe|chr 3|||Manual Length = 141 Score = 26.2 bits (55), Expect = 2.5 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = -2 Query: 208 CFLREFSLLISGFFYDIK 155 C+++ FSLLIS FF I+ Sbjct: 118 CYIQSFSLLISNFFIAIE 135 >SPCC794.04c |||membrane transporter|Schizosaccharomyces pombe|chr 3|||Manual Length = 547 Score = 25.4 bits (53), Expect = 4.4 Identities = 9/33 (27%), Positives = 17/33 (51%) Frame = -1 Query: 344 LAYLHKKREVEFIDGNLCLSTTILKCRFFAYLL 246 + Y+H +R E DGN+C + F ++ + Sbjct: 396 IIYVHYRRRYEMRDGNICPEDRLFPLFFGSFFI 428 >SPCC18B5.01c |bfr1|hba2, SPCPJ732.04c|brefeldin A efflux transporter Bfr1|Schizosaccharomyces pombe|chr 3|||Manual Length = 1530 Score = 25.0 bits (52), Expect = 5.8 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -2 Query: 190 SLLISGFFYDIKQETFNVF 134 SL+I FYD+K T +VF Sbjct: 552 SLIIGSIFYDMKLNTVDVF 570 >SPAC3C7.01c ||SPAC732.03c|inositol polyphosphate phosphatase |Schizosaccharomyces pombe|chr 1|||Manual Length = 611 Score = 25.0 bits (52), Expect = 5.8 Identities = 19/44 (43%), Positives = 25/44 (56%), Gaps = 2/44 (4%) Frame = -2 Query: 289 CRRPY*NVAFSHIYYKHIKHRNVSR-LLCFLREF-SLLISGFFY 164 C+R N S++YY + H+ SR L FL E SLLI G +Y Sbjct: 328 CKRNK-NPPLSYVYYDY--HKQGSRNLPLFLAEIQSLLIEGKYY 368 >SPAP27G11.15 |slx1||structure-specific endonuclease catalytic subunit |Schizosaccharomyces pombe|chr 1|||Manual Length = 271 Score = 24.6 bits (51), Expect = 7.6 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = -1 Query: 371 INVYKNYETLAYLHKKREVEFIDGNLCLSTTI 276 INVY + E L H+K + D LCL TI Sbjct: 143 INVYFDEEWLNGFHEKVIQKTYDHKLCLRKTI 174 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,859,725 Number of Sequences: 5004 Number of extensions: 35719 Number of successful extensions: 102 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 100 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 102 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 178394480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -