BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0506 (467 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_01_0132 - 1601421-1601657,1601761-1601922,1602812-1603721,160... 28 4.3 >10_01_0132 - 1601421-1601657,1601761-1601922,1602812-1603721, 1604587-1604651,1604704-1604746,1605086-1605128, 1605874-1605955,1606270-1606464,1606567-1606721, 1611207-1611435,1611538-1611693,1612539-1613476, 1614946-1614967 Length = 1078 Score = 27.9 bits (59), Expect = 4.3 Identities = 14/30 (46%), Positives = 17/30 (56%), Gaps = 2/30 (6%) Frame = -3 Query: 285 DDHIEMSLFRIFTINIS--NTVMYQDCCVS 202 D HI +I TINIS + V DCC+S Sbjct: 850 DHHISSQTLKILTINISDFSFVDKYDCCIS 879 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,589,541 Number of Sequences: 37544 Number of extensions: 183940 Number of successful extensions: 362 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 354 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 362 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 943260316 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -