BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0506 (467 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z68114-7|CAA92161.1| 317|Caenorhabditis elegans Hypothetical pr... 27 5.1 AC024775-8|AAK68458.1| 347|Caenorhabditis elegans Hypothetical ... 27 8.9 >Z68114-7|CAA92161.1| 317|Caenorhabditis elegans Hypothetical protein F17A2.10 protein. Length = 317 Score = 27.5 bits (58), Expect = 5.1 Identities = 15/48 (31%), Positives = 22/48 (45%) Frame = -1 Query: 371 INVYKNYETLAYLHKKREVEFIDGNLCLSTTILKCRFFAYLL*TYQTP 228 I +Y YE + +H++R +F L LS + AYL Y P Sbjct: 107 ITMYVKYEAVRSIHRERSAKFSVIILSLSPLFITMSAEAYLTIEYHLP 154 >AC024775-8|AAK68458.1| 347|Caenorhabditis elegans Hypothetical protein Y41D4A.8 protein. Length = 347 Score = 26.6 bits (56), Expect = 8.9 Identities = 15/38 (39%), Positives = 19/38 (50%) Frame = -1 Query: 371 INVYKNYETLAYLHKKREVEFIDGNLCLSTTILKCRFF 258 I V Y+++ +L KKR FI G L S RFF Sbjct: 169 IGVCHPYKSVEWLPKKRVTTFIIGLLTFSVIFNTTRFF 206 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,137,242 Number of Sequences: 27780 Number of extensions: 197269 Number of successful extensions: 371 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 367 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 371 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 839684522 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -