BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0505 (478 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 23 1.4 DQ855501-1|ABH88188.1| 146|Tribolium castaneum chemosensory pro... 22 3.3 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 23.0 bits (47), Expect = 1.4 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = +1 Query: 313 TLCLANKGXSPHQTAWNYVKCYHXKDPKHXS 405 TLC +KG SP Q + Y + +H S Sbjct: 303 TLCNGSKGISPEQEELIHRLVYFQNEYEHPS 333 >DQ855501-1|ABH88188.1| 146|Tribolium castaneum chemosensory protein 15 protein. Length = 146 Score = 21.8 bits (44), Expect = 3.3 Identities = 11/51 (21%), Positives = 25/51 (49%) Frame = +2 Query: 17 TFIVFVVCVVLAQALTDXQKENLKKHRADCLSETKADEQLVNKLKTGXFKT 169 T++ V ++L + T + + + ++ DC+ + + KLK G +T Sbjct: 15 TYVSSVEYLILREIDTILKNDQMTRNYLDCVLDKGKCTKEAEKLKKGITET 65 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 82,678 Number of Sequences: 336 Number of extensions: 1326 Number of successful extensions: 4 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 11141978 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -