BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0505 (478 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBP4H10.05c |spe2||S-adenosylmethionine decarboxylase proenzyme... 25 5.9 SPBPJ4664.01 |dps1|SPBPJ694.01|decaprenyl diphosphate synthase s... 25 7.9 >SPBP4H10.05c |spe2||S-adenosylmethionine decarboxylase proenzyme Spe2|Schizosaccharomyces pombe|chr 2|||Manual Length = 378 Score = 25.0 bits (52), Expect = 5.9 Identities = 11/35 (31%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = +3 Query: 348 PNSLELCEMLPXERPXAXLFSXKHIXQPNRSI-PH 449 P LE+ + +RP +S K+ P R + PH Sbjct: 109 PRLLEIASSVGFDRPLRIFYSRKNFLYPERQLAPH 143 >SPBPJ4664.01 |dps1|SPBPJ694.01|decaprenyl diphosphate synthase subunit Dps1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 378 Score = 24.6 bits (51), Expect = 7.9 Identities = 17/47 (36%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Frame = +2 Query: 188 KYALCMLIKSQLMTKDGKFT-KDLALAKVPNAEDKLXVEEAD*RFAW 325 +Y C+ QLM +T KD L K A+ KL + A FAW Sbjct: 257 EYGRCIGTAFQLMDDVLDYTSKDDTLGKAAGADLKLGLATAPVLFAW 303 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,461,753 Number of Sequences: 5004 Number of extensions: 22990 Number of successful extensions: 71 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 70 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 71 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 184476110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -