BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0499 (481 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_35032| Best HMM Match : MED7 (HMM E-Value=7.6e-08) 30 0.86 SB_36566| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.0 >SB_35032| Best HMM Match : MED7 (HMM E-Value=7.6e-08) Length = 418 Score = 30.3 bits (65), Expect = 0.86 Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 3/50 (6%) Frame = +3 Query: 96 GTCPELKPVNNFNLTAYQGIWYEI-SKFPNES--EXNGKXSSAEYKLEGD 236 G C + V N+T+Y G WY++ S F E E N +A+Y L D Sbjct: 233 GPCQGIDTVPTLNVTSYLGRWYQMYSDFIVEETFERNAVCVTADYTLRKD 282 >SB_36566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1653 Score = 27.1 bits (57), Expect = 8.0 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +3 Query: 183 ESEXNGKXSSAEYKLEGDVAKVKNCISSTASXK 281 + E +GK +A+ GD K+ I +TAS K Sbjct: 836 DDEDDGKKKTAKVDANGDEYKIDEAIKNTASAK 868 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,784,205 Number of Sequences: 59808 Number of extensions: 175453 Number of successful extensions: 340 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 332 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 340 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1001731762 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -