BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0499 (481 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ067178-1|AAZ20250.1| 448|Apis mellifera conserved ATPase doma... 23 2.2 AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cycl... 22 3.9 >DQ067178-1|AAZ20250.1| 448|Apis mellifera conserved ATPase domain protein protein. Length = 448 Score = 22.6 bits (46), Expect = 2.2 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Frame = -2 Query: 183 RWEISRFHTRC--LGKLSS*SCSPVSARGRCLRE*LQQS 73 RW++ +FH C +G S S V A GR E Q++ Sbjct: 186 RWDLGKFHRVCTQIGS-SMKSVGEVMAIGRKFEEAFQKA 223 >AB204559-1|BAD89804.1| 832|Apis mellifera soluble guanylyl cyclase beta-3 protein. Length = 832 Score = 21.8 bits (44), Expect = 3.9 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -3 Query: 254 VLDLRHVTFQFVFS*RAF 201 + D HVTF+ F RAF Sbjct: 170 LFDTVHVTFKLTFDNRAF 187 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 98,002 Number of Sequences: 438 Number of extensions: 1770 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 13051674 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -