BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0493 (480 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_18582| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.37 SB_8363| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.86 SB_16848| Best HMM Match : Ion_trans_2 (HMM E-Value=0.083) 29 2.6 SB_24758| Best HMM Match : 7tm_1 (HMM E-Value=5.3e-10) 28 4.6 SB_38071| Best HMM Match : ABC_membrane (HMM E-Value=1.2e-11) 28 4.6 SB_8061| Best HMM Match : Homeobox (HMM E-Value=5.1e-27) 27 8.0 SB_50227| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.0 >SB_18582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 499 Score = 31.5 bits (68), Expect = 0.37 Identities = 19/44 (43%), Positives = 24/44 (54%), Gaps = 1/44 (2%) Frame = +3 Query: 282 EDKLKVEKLIDACLANKGNSPHQTAWNYVKCYHEKDPK-HALFL 410 E+ + V KL D L NKG PH N ++E DPK H LF+ Sbjct: 341 EESVDVTKL-DYYLMNKGYIPHADRLNDTLHHYETDPKYHRLFI 383 >SB_8363| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 776 Score = 30.3 bits (65), Expect = 0.86 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = -3 Query: 187 SMVRFQS*SRLSSVCSPIVHQLSSRRDSRLCVSSSSPSAHL*GP 56 S + +S S SSVC ++H+LS+ R +C S A+ P Sbjct: 430 SYIVCRSISYTSSVCRSVIHRLSANRSKTVCRSIGHTGAYTGAP 473 >SB_16848| Best HMM Match : Ion_trans_2 (HMM E-Value=0.083) Length = 283 Score = 28.7 bits (61), Expect = 2.6 Identities = 23/81 (28%), Positives = 39/81 (48%) Frame = +3 Query: 222 ADDQGREIQEGVALAKVPNAEDKLKVEKLIDACLANKGNSPHQTAWNYVKCYHEKDPKHA 401 A+ +G EI V + D L+ +K++D L ++ TA +YV+ YHE KH+ Sbjct: 175 AEKEGSEI---VGYKTFQDMADALE-KKIVDGILIDR-----YTAGSYVRHYHENKLKHS 225 Query: 402 LFL*THNPTQPFHTSLVLNSS 464 L +H V++S+ Sbjct: 226 LISASHVQISGQQIGFVISSN 246 >SB_24758| Best HMM Match : 7tm_1 (HMM E-Value=5.3e-10) Length = 367 Score = 27.9 bits (59), Expect = 4.6 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = -1 Query: 135 LFISFRLG--ETVGSVFLQVLLLLICEGLSQDNADDEHDK 22 LF++F G E VG F+ L CE D DD+H++ Sbjct: 305 LFLAFNRGYRELVGRAFIYTCCTL-CEIAEDDENDDDHER 343 >SB_38071| Best HMM Match : ABC_membrane (HMM E-Value=1.2e-11) Length = 1214 Score = 27.9 bits (59), Expect = 4.6 Identities = 11/33 (33%), Positives = 23/33 (69%) Frame = +1 Query: 187 KKYALCMLIKSQLMTKDGKFKKESLWLKCLMLK 285 ++ ALC +I+++L+TKDG+ ++ + C L+ Sbjct: 1175 RRNALCEVIENRLVTKDGRSLSQAGRILCYRLR 1207 >SB_8061| Best HMM Match : Homeobox (HMM E-Value=5.1e-27) Length = 418 Score = 27.1 bits (57), Expect = 8.0 Identities = 13/47 (27%), Positives = 26/47 (55%) Frame = +3 Query: 174 KRTIEEVCSMYADQITADDQGREIQEGVALAKVPNAEDKLKVEKLID 314 K+T + + + +ITA + + +GV+L K+ A D + KL++ Sbjct: 332 KKTHKPLYTSLKHEITARSSHKPLTDGVSLRKIQLASDVVPSSKLLE 378 >SB_50227| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 276 Score = 27.1 bits (57), Expect = 8.0 Identities = 14/47 (29%), Positives = 20/47 (42%) Frame = +3 Query: 195 CSMYADQITADDQGREIQEGVALAKVPNAEDKLKVEKLIDACLANKG 335 C Y + D + I EG + + PN E L + L+ NKG Sbjct: 51 CGFYYTEEQVLDIRKAIPEGTRVNEFPNCEHDLITKPLVSGSEKNKG 97 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,481,035 Number of Sequences: 59808 Number of extensions: 287637 Number of successful extensions: 916 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 879 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 916 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1001731762 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -