BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0489 (482 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q236R6 Cluster: Putative uncharacterized protein; n=1; ... 32 5.9 UniRef50_A5K9K8 Cluster: Putative uncharacterized protein; n=1; ... 32 5.9 >UniRef50_Q236R6 Cluster: Putative uncharacterized protein; n=1; Tetrahymena thermophila SB210|Rep: Putative uncharacterized protein - Tetrahymena thermophila SB210 Length = 1555 Score = 32.3 bits (70), Expect = 5.9 Identities = 17/50 (34%), Positives = 25/50 (50%) Frame = -3 Query: 387 INSHXFIKKSSMTS*NVECKYCLQLN*CNQRNXGLSYYFVKQESQQNCVC 238 I+ H F K +++ + CK CL N C N +Y FV+ E + N C Sbjct: 79 IDGHYFDKSNNLQKCPINCKKCLNSNNCLDCNE--NYSFVQGECECNGTC 126 >UniRef50_A5K9K8 Cluster: Putative uncharacterized protein; n=1; Plasmodium vivax|Rep: Putative uncharacterized protein - Plasmodium vivax Length = 820 Score = 32.3 bits (70), Expect = 5.9 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = +2 Query: 59 SCI*CMNTNYCFNKTFKYNLLCDFNVSRN 145 SC C N ++C+N YN C +N RN Sbjct: 430 SCNHCYNYDHCYNYDHCYNYSCSYNYDRN 458 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 382,192,970 Number of Sequences: 1657284 Number of extensions: 6420344 Number of successful extensions: 11011 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 10584 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11006 length of database: 575,637,011 effective HSP length: 94 effective length of database: 419,852,315 effective search space used: 27710252790 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -