BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0489 (482 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC106.09 |cut4|apc1|anaphase-promoting complex subunit Apc1|Sc... 27 1.1 SPAC1F7.03 |pkd2||TRP-like ion channel |Schizosaccharomyces pomb... 25 6.0 >SPBC106.09 |cut4|apc1|anaphase-promoting complex subunit Apc1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1458 Score = 27.5 bits (58), Expect = 1.1 Identities = 11/30 (36%), Positives = 20/30 (66%) Frame = +2 Query: 302 LH*FSCKQYLHSTF*DVIEDFFIKXWEFIY 391 L+ F +QYL + D++ED ++ WE++Y Sbjct: 1421 LNKFHSRQYLFLSR-DLVEDLSLRVWEYVY 1449 >SPAC1F7.03 |pkd2||TRP-like ion channel |Schizosaccharomyces pombe|chr 1|||Manual Length = 710 Score = 25.0 bits (52), Expect = 6.0 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = -3 Query: 204 IDMIFFISNNVKISIKVLGLFLDTL 130 I +IFF N + + + +LG+F+ TL Sbjct: 555 IGIIFFALNAITMLLLILGIFIRTL 579 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,718,806 Number of Sequences: 5004 Number of extensions: 30393 Number of successful extensions: 31 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 186042952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -