BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0482 (487 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C prot... 21 5.3 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 21 7.0 AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. 21 7.0 AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 21 9.2 AB073998-1|BAC76402.1| 339|Apis mellifera preprotachykinin prot... 21 9.2 AB073995-1|BAC76399.1| 301|Apis mellifera preprotachykinin prot... 21 9.2 >AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C protein. Length = 149 Score = 21.4 bits (43), Expect = 5.3 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +1 Query: 127 GMCKAGFAGD 156 GMCK G +GD Sbjct: 130 GMCKEGISGD 139 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.0 bits (42), Expect = 7.0 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -2 Query: 186 DRGEHGARSIISCETGLA 133 D GEH ++ E GLA Sbjct: 130 DPGEHNGDTVTDVEAGLA 147 >AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. Length = 289 Score = 21.0 bits (42), Expect = 7.0 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -2 Query: 186 DRGEHGARSIISCETGLA 133 D GEH ++ E GLA Sbjct: 125 DPGEHNGDTVTDVEAGLA 142 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 20.6 bits (41), Expect = 9.2 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +1 Query: 1 RHEVSSHCRAFNFHLV 48 R V+S C+AF +H V Sbjct: 285 RMGVASFCKAFPWHFV 300 >AB073998-1|BAC76402.1| 339|Apis mellifera preprotachykinin protein. Length = 339 Score = 20.6 bits (41), Expect = 9.2 Identities = 11/45 (24%), Positives = 20/45 (44%) Frame = +3 Query: 192 KAPPSGRDGRYGTEGLVRRRRAQSKRGILTLKYPIEHGIVTNWDD 326 K P G G G + ++ KRG++ + ++ T +DD Sbjct: 180 KRAPMGFYGTRGKKIILDALEELDKRGVMDFQIGLQRKKDTTFDD 224 >AB073995-1|BAC76399.1| 301|Apis mellifera preprotachykinin protein. Length = 301 Score = 20.6 bits (41), Expect = 9.2 Identities = 11/45 (24%), Positives = 20/45 (44%) Frame = +3 Query: 192 KAPPSGRDGRYGTEGLVRRRRAQSKRGILTLKYPIEHGIVTNWDD 326 K P G G G + ++ KRG++ + ++ T +DD Sbjct: 180 KRAPMGFYGTRGKKIILDALEELDKRGVMDFQIGLQRKKDTTFDD 224 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 144,183 Number of Sequences: 438 Number of extensions: 3256 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 13297932 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -