BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0479 (455 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF274024-1|AAF90150.1| 232|Apis mellifera tetraspanin F139 prot... 22 3.6 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 21 6.3 >AF274024-1|AAF90150.1| 232|Apis mellifera tetraspanin F139 protein. Length = 232 Score = 21.8 bits (44), Expect = 3.6 Identities = 13/40 (32%), Positives = 17/40 (42%) Frame = -2 Query: 166 IVLMNYSFICDIFSENFSLILSKILTYGNGKVIESSRSDF 47 I + Y+FI +NF I K NG + S DF Sbjct: 96 IAVAVYAFIVVKNDDNFRNISEKYQEIFNGYFLNSESKDF 135 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 21.0 bits (42), Expect = 6.3 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = -2 Query: 109 ILSKILTYGNGKVIESSRSDFYTT 38 ++ KI +G + IES+ YTT Sbjct: 772 LVCKIADFGLSREIESATEGAYTT 795 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 102,387 Number of Sequences: 438 Number of extensions: 1768 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 12066642 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -