BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0470 (455 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 24 2.9 AF487780-1|AAL96667.1| 490|Anopheles gambiae cytochrome P450 CY... 23 5.1 AY823259-1|AAX18444.1| 194|Anopheles gambiae pburs protein. 23 6.7 U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles ... 22 8.9 AF080564-1|AAC31944.1| 372|Anopheles gambiae Sex combs reduced ... 22 8.9 AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcript... 22 8.9 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 23.8 bits (49), Expect = 2.9 Identities = 21/70 (30%), Positives = 29/70 (41%), Gaps = 5/70 (7%) Frame = -3 Query: 264 PQFLRGTYCSRYVLPPKPLSSAVHIRRTPSARTVESRQRSL---SSYPNRRYGSWDQVHP 94 PQ +R S L P P + VH + + T+ R L YP+ S+ + P Sbjct: 1364 PQAIRKAVSSLLALRPLPKPTQVHFKASLQGITLTDNTRQLFFRRHYPSNNV-SFCALDP 1422 Query: 93 D--RTSISDT 70 D R SI T Sbjct: 1423 DDRRWSIQST 1432 >AF487780-1|AAL96667.1| 490|Anopheles gambiae cytochrome P450 CYP6Z2 protein protein. Length = 490 Score = 23.0 bits (47), Expect = 5.1 Identities = 18/60 (30%), Positives = 27/60 (45%) Frame = +3 Query: 135 KKRATVDDFPLCVHLVSDEYEQLSSEALEAGRICCNKYLVRTAERISSISA*DFTLSTLS 314 K + T DF + + E ++ S EAL + N +L A +S + FTL LS Sbjct: 257 KNQITRKDFVQLLIDLRREADKGSEEALTIEQCAANVFLFYIAGAETSTATISFTLHELS 316 >AY823259-1|AAX18444.1| 194|Anopheles gambiae pburs protein. Length = 194 Score = 22.6 bits (46), Expect = 6.7 Identities = 7/19 (36%), Positives = 13/19 (68%) Frame = +3 Query: 147 TVDDFPLCVHLVSDEYEQL 203 T + P +HL+ +EY++L Sbjct: 84 TCETLPSEIHLIKEEYDEL 102 >U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles gambiae putativetubulin alpha chain mRNA, complete cds. ). Length = 91 Score = 22.2 bits (45), Expect = 8.9 Identities = 10/26 (38%), Positives = 12/26 (46%) Frame = -1 Query: 104 RYTPTEPRFRIRFIFAVPVASRWPAP 27 R TP+ PR VP +S W P Sbjct: 48 RSTPSSPRLAQASTCPVPCSSIWSRP 73 >AF080564-1|AAC31944.1| 372|Anopheles gambiae Sex combs reduced homeotic protein protein. Length = 372 Score = 22.2 bits (45), Expect = 8.9 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -2 Query: 244 LLQQIRPASKASELSCSYSSDTKCT 170 L QQ +P S + SC Y+S+ T Sbjct: 111 LSQQQQPQSALTSQSCKYASEGPST 135 >AB097127-1|BAC82595.1| 1209|Anopheles gambiae reverse transcriptase protein. Length = 1209 Score = 22.2 bits (45), Expect = 8.9 Identities = 8/16 (50%), Positives = 12/16 (75%) Frame = +3 Query: 108 PKIRIFDLGKKRATVD 155 P I +++ KKRAT+D Sbjct: 1103 PDILVYEKRKKRATID 1118 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 518,370 Number of Sequences: 2352 Number of extensions: 10699 Number of successful extensions: 17 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 39119412 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -