BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0466 (418 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_4413| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 3e-09 SB_23120| Best HMM Match : Mucin (HMM E-Value=0.033) 30 0.67 >SB_4413| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 58.0 bits (134), Expect = 3e-09 Identities = 30/50 (60%), Positives = 36/50 (72%), Gaps = 1/50 (2%) Frame = +2 Query: 218 QTREHLLVF-FTNQEFEIIDXFLGPSLNDEVLKIMPVQKQTRAXXXHTFQ 364 +T EH+ +F +EFEIID FLG +L DEVLKIMPVQKQTRA F+ Sbjct: 24 KTLEHIYLFSLPIKEFEIIDFFLGAALKDEVLKIMPVQKQTRAGQRTRFK 73 Score = 57.6 bits (133), Expect = 4e-09 Identities = 33/69 (47%), Positives = 39/69 (56%) Frame = +3 Query: 168 WVPVTKLGRLVREGKIDKLESIYLFSLPIKNSRSLIXFSARP*MMRFLRSCLYRNKHVPD 347 WVPVTKLGRLV++ KI LE IYLFSLPIK + F L+ + + Sbjct: 8 WVPVTKLGRLVKDLKIKTLEHIYLFSLPIKEFEIIDFFLGAALKDEVLKIMPVQKQTRAG 67 Query: 348 XXTRFKAFV 374 TRFKAFV Sbjct: 68 QRTRFKAFV 76 >SB_23120| Best HMM Match : Mucin (HMM E-Value=0.033) Length = 382 Score = 30.3 bits (65), Expect = 0.67 Identities = 14/37 (37%), Positives = 17/37 (45%) Frame = -2 Query: 192 GRVW*QEPTLSGLPCRAHDHGRDHDRVHEDRHGLYLH 82 G +W + L LP H DHDR H RH +H Sbjct: 103 GFLWQKNGVLLSLPPPQFRHSHDHDRHHYHRHHNNIH 139 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,758,124 Number of Sequences: 59808 Number of extensions: 186830 Number of successful extensions: 542 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 493 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 541 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 777158991 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -