BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0466 (418 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alp... 24 0.60 EF013389-1|ABK54743.1| 172|Apis mellifera elongation factor 1-a... 24 0.60 AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-a... 24 0.60 AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1al... 24 0.60 AB208106-1|BAE72138.1| 111|Apis mellifera Broad complex zinc fi... 24 0.79 AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex det... 22 2.4 AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. 22 2.4 S76957-1|AAB33932.1| 169|Apis mellifera olfactory receptor prot... 22 3.2 S76956-1|AAB33931.1| 168|Apis mellifera olfactory receptor prot... 22 3.2 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 22 3.2 X16709-1|CAA34681.1| 162|Apis mellifera phospholipase A-2 protein. 21 4.2 L10433-1|AAA27732.1| 149|Apis mellifera transposase protein. 21 4.2 EF373554-1|ABQ28728.1| 167|Apis mellifera phospholipase A2 prot... 21 4.2 DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex det... 21 4.2 DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex det... 21 4.2 DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex det... 21 4.2 DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex det... 21 4.2 DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex det... 21 4.2 DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex det... 21 4.2 DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex det... 21 4.2 DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex det... 21 4.2 DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex det... 21 4.2 DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex det... 21 4.2 DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex det... 21 4.2 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 21 4.2 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 21 4.2 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 21 4.2 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 21 4.2 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 21 4.2 AF438408-1|AAL30844.1| 167|Apis mellifera phospholipase A2 prot... 21 4.2 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 21 5.6 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 21 5.6 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 21 5.6 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 21 7.4 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 21 7.4 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 21 7.4 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 21 7.4 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 21 7.4 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 21 7.4 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 21 7.4 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 21 7.4 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 21 7.4 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 21 7.4 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 21 7.4 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 21 7.4 AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex det... 21 7.4 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 21 7.4 AB194707-1|BAD69622.1| 247|Apis mellifera heme oxygenase protein. 21 7.4 DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex det... 20 9.7 DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex det... 20 9.7 DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex det... 20 9.7 DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex det... 20 9.7 DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex det... 20 9.7 DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex det... 20 9.7 DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex det... 20 9.7 DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex det... 20 9.7 DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex det... 20 9.7 DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex det... 20 9.7 DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex det... 20 9.7 DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex det... 20 9.7 DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex det... 20 9.7 DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex det... 20 9.7 DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex det... 20 9.7 DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex det... 20 9.7 DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex det... 20 9.7 DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex det... 20 9.7 DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex det... 20 9.7 DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex det... 20 9.7 DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex det... 20 9.7 DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex det... 20 9.7 >X52884-1|CAA37066.1| 461|Apis mellifera elongation factor 1 alpha protein. Length = 461 Score = 24.2 bits (50), Expect = 0.60 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = +2 Query: 209 KNRQTREHLLVFFT 250 KN QTREH L+ FT Sbjct: 129 KNGQTREHALLAFT 142 >EF013389-1|ABK54743.1| 172|Apis mellifera elongation factor 1-alpha protein. Length = 172 Score = 24.2 bits (50), Expect = 0.60 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = +2 Query: 209 KNRQTREHLLVFFT 250 KN QTREH L+ FT Sbjct: 56 KNGQTREHALLAFT 69 >AY208278-1|AAO48970.1| 274|Apis mellifera elongation factor 1-alpha protein. Length = 274 Score = 24.2 bits (50), Expect = 0.60 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = +2 Query: 209 KNRQTREHLLVFFT 250 KN QTREH L+ FT Sbjct: 72 KNGQTREHALLAFT 85 >AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1alpha F2 protein. Length = 461 Score = 24.2 bits (50), Expect = 0.60 Identities = 10/14 (71%), Positives = 11/14 (78%) Frame = +2 Query: 209 KNRQTREHLLVFFT 250 KN QTREH L+ FT Sbjct: 129 KNGQTREHALLAFT 142 >AB208106-1|BAE72138.1| 111|Apis mellifera Broad complex zinc finger domain-Z1 isoform protein. Length = 111 Score = 23.8 bits (49), Expect = 0.79 Identities = 9/28 (32%), Positives = 16/28 (57%) Frame = -2 Query: 87 LHRVIRIRRENRHVHRLEQRXPLLNSCR 4 L + R+RR ++VH + P+ N C+ Sbjct: 12 LTSLTRLRRHIQNVHTRPSKEPICNICK 39 >AY350615-1|AAQ57657.1| 410|Apis mellifera complementary sex determiner protein. Length = 410 Score = 22.2 bits (45), Expect = 2.4 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = +2 Query: 161 ERVGSCHQTRPSCSRRKNRQTRE 229 + S + SCSR +NR+ RE Sbjct: 225 QHTSSRYSRERSCSRDRNREYRE 247 >AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. Length = 388 Score = 22.2 bits (45), Expect = 2.4 Identities = 8/30 (26%), Positives = 16/30 (53%) Frame = -3 Query: 242 KQVNALEFVDFSFANKTAEFGDRNPLFLVF 153 + +++ + V++ T GD P+FL F Sbjct: 355 QDISSPDAVEYGIIGPTTCMGDHKPVFLEF 384 >S76957-1|AAB33932.1| 169|Apis mellifera olfactory receptor protein. Length = 169 Score = 21.8 bits (44), Expect = 3.2 Identities = 9/22 (40%), Positives = 10/22 (45%) Frame = +2 Query: 353 HTFQGICLPLSTTTVIFGFGCE 418 HT CLP VI F C+ Sbjct: 39 HTTNAFCLPFCGPNVINPFFCD 60 >S76956-1|AAB33931.1| 168|Apis mellifera olfactory receptor protein. Length = 168 Score = 21.8 bits (44), Expect = 3.2 Identities = 9/22 (40%), Positives = 10/22 (45%) Frame = +2 Query: 353 HTFQGICLPLSTTTVIFGFGCE 418 HT CLP VI F C+ Sbjct: 38 HTTNAFCLPFCGPNVINPFFCD 59 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 21.8 bits (44), Expect = 3.2 Identities = 10/20 (50%), Positives = 14/20 (70%), Gaps = 1/20 (5%) Frame = +2 Query: 173 SCHQTRP-SCSRRKNRQTRE 229 S H +R SCSR +NR+ +E Sbjct: 228 SSHYSRERSCSRDRNREYKE 247 >X16709-1|CAA34681.1| 162|Apis mellifera phospholipase A-2 protein. Length = 162 Score = 21.4 bits (43), Expect = 4.2 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = -2 Query: 150 CRAHDHGRDHDRVHEDRHGL 91 CR HD D E +HGL Sbjct: 59 CRTHDMCPDVMSAGESKHGL 78 >L10433-1|AAA27732.1| 149|Apis mellifera transposase protein. Length = 149 Score = 21.4 bits (43), Expect = 4.2 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = +1 Query: 205 KEKSTNSRAFTCFLYQSRIRDH*FXSRPV 291 KEK R +C L + R + F RP+ Sbjct: 1 KEKHLTQRINSCDLLKKRNENDPFLKRPI 29 >EF373554-1|ABQ28728.1| 167|Apis mellifera phospholipase A2 protein. Length = 167 Score = 21.4 bits (43), Expect = 4.2 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = -2 Query: 150 CRAHDHGRDHDRVHEDRHGL 91 CR HD D E +HGL Sbjct: 64 CRTHDMCPDVMSAGESKHGL 83 >DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 4.2 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +2 Query: 194 SCSRRKNRQTRE 229 SCSR +NR+ RE Sbjct: 3 SCSRDRNREYRE 14 >DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 4.2 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +2 Query: 194 SCSRRKNRQTRE 229 SCSR +NR+ RE Sbjct: 3 SCSRDRNREYRE 14 >DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 4.2 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +2 Query: 194 SCSRRKNRQTRE 229 SCSR +NR+ RE Sbjct: 3 SCSRDRNREYRE 14 >DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 4.2 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +2 Query: 194 SCSRRKNRQTRE 229 SCSR +NR+ RE Sbjct: 3 SCSRDRNREYRE 14 >DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 4.2 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +2 Query: 194 SCSRRKNRQTRE 229 SCSR +NR+ RE Sbjct: 3 SCSRDRNREYRE 14 >DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 4.2 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +2 Query: 194 SCSRRKNRQTRE 229 SCSR +NR+ RE Sbjct: 3 SCSRDRNREYRE 14 >DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 4.2 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +2 Query: 194 SCSRRKNRQTRE 229 SCSR +NR+ RE Sbjct: 3 SCSRDRNREYRE 14 >DQ325109-1|ABD14123.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.4 bits (43), Expect = 4.2 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +2 Query: 194 SCSRRKNRQTRE 229 SCSR +NR+ RE Sbjct: 3 SCSRDRNREYRE 14 >DQ325108-1|ABD14122.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.4 bits (43), Expect = 4.2 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +2 Query: 194 SCSRRKNRQTRE 229 SCSR +NR+ RE Sbjct: 3 SCSRDRNREYRE 14 >DQ325107-1|ABD14121.1| 176|Apis mellifera complementary sex determiner protein. Length = 176 Score = 21.4 bits (43), Expect = 4.2 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +2 Query: 194 SCSRRKNRQTRE 229 SCSR +NR+ RE Sbjct: 3 SCSRDRNREYRE 14 >DQ325106-1|ABD14120.1| 177|Apis mellifera complementary sex determiner protein. Length = 177 Score = 21.4 bits (43), Expect = 4.2 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = +2 Query: 194 SCSRRKNRQTRE 229 SCSR +NR+ RE Sbjct: 3 SCSRDRNREYRE 14 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 4.2 Identities = 10/20 (50%), Positives = 14/20 (70%), Gaps = 1/20 (5%) Frame = +2 Query: 173 SCHQTRP-SCSRRKNRQTRE 229 S H +R SCSR +NR+ R+ Sbjct: 228 SSHYSRERSCSRDRNREYRK 247 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 4.2 Identities = 10/20 (50%), Positives = 14/20 (70%), Gaps = 1/20 (5%) Frame = +2 Query: 173 SCHQTRP-SCSRRKNRQTRE 229 S H +R SCSR +NR+ R+ Sbjct: 228 SSHYSRERSCSRDRNREYRK 247 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 4.2 Identities = 10/20 (50%), Positives = 14/20 (70%), Gaps = 1/20 (5%) Frame = +2 Query: 173 SCHQTRP-SCSRRKNRQTRE 229 S H +R SCSR +NR+ R+ Sbjct: 228 SSHYSRERSCSRDRNREYRK 247 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.4 bits (43), Expect = 4.2 Identities = 10/20 (50%), Positives = 14/20 (70%), Gaps = 1/20 (5%) Frame = +2 Query: 173 SCHQTRP-SCSRRKNRQTRE 229 S H +R SCSR +NR+ R+ Sbjct: 228 SSHYSRERSCSRDRNREYRK 247 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.4 bits (43), Expect = 4.2 Identities = 10/20 (50%), Positives = 14/20 (70%), Gaps = 1/20 (5%) Frame = +2 Query: 173 SCHQTRP-SCSRRKNRQTRE 229 S H +R SCSR +NR+ R+ Sbjct: 217 SSHYSRERSCSRDRNREYRK 236 >AF438408-1|AAL30844.1| 167|Apis mellifera phospholipase A2 protein. Length = 167 Score = 21.4 bits (43), Expect = 4.2 Identities = 9/20 (45%), Positives = 10/20 (50%) Frame = -2 Query: 150 CRAHDHGRDHDRVHEDRHGL 91 CR HD D E +HGL Sbjct: 64 CRTHDMCPDVMSAGESKHGL 83 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.0 bits (42), Expect = 5.6 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = +2 Query: 161 ERVGSCHQTRPSCSRRKNRQTRE 229 + S + SCSR +NR+ +E Sbjct: 214 QHTSSRYSRERSCSRDRNREYKE 236 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 21.0 bits (42), Expect = 5.6 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = +2 Query: 161 ERVGSCHQTRPSCSRRKNRQTRE 229 + S + SCSR +NR+ +E Sbjct: 225 QHTSSRYSRERSCSRDRNREYKE 247 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 21.0 bits (42), Expect = 5.6 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = +2 Query: 161 ERVGSCHQTRPSCSRRKNRQTRE 229 + S + SCSR +NR+ +E Sbjct: 225 QHTSSRYSRERSCSRDRNREYKE 247 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 20.6 bits (41), Expect = 7.4 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = +2 Query: 161 ERVGSCHQTRPSCSRRKNRQTRE 229 + S + SCSR +NR+ R+ Sbjct: 214 QHTSSRYSRERSCSRDRNREYRK 236 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 20.6 bits (41), Expect = 7.4 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = +2 Query: 161 ERVGSCHQTRPSCSRRKNRQTRE 229 + S + SCSR +NR+ R+ Sbjct: 225 QHTSSRYSRERSCSRDRNREYRK 247 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 20.6 bits (41), Expect = 7.4 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = +2 Query: 161 ERVGSCHQTRPSCSRRKNRQTRE 229 + S + SCSR +NR+ R+ Sbjct: 225 QHTSSRYSRERSCSRDRNREYRK 247 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 20.6 bits (41), Expect = 7.4 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = +2 Query: 161 ERVGSCHQTRPSCSRRKNRQTRE 229 + S + SCSR +NR+ R+ Sbjct: 214 QHTSSRYSRERSCSRDRNREYRK 236 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 20.6 bits (41), Expect = 7.4 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = +2 Query: 161 ERVGSCHQTRPSCSRRKNRQTRE 229 + S + SCSR +NR+ R+ Sbjct: 225 QHTSSRYSRERSCSRDRNREYRK 247 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 20.6 bits (41), Expect = 7.4 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = +2 Query: 161 ERVGSCHQTRPSCSRRKNRQTRE 229 + S + SCSR +NR+ R+ Sbjct: 225 QHTSSRYSRERSCSRDRNREYRK 247 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 20.6 bits (41), Expect = 7.4 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = +2 Query: 161 ERVGSCHQTRPSCSRRKNRQTRE 229 + S + SCSR +NR+ R+ Sbjct: 214 QHTSSRYSRERSCSRDRNREYRK 236 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 20.6 bits (41), Expect = 7.4 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = +2 Query: 161 ERVGSCHQTRPSCSRRKNRQTRE 229 + S + SCSR +NR+ R+ Sbjct: 225 QHTSSRYSRERSCSRDRNREYRK 247 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 20.6 bits (41), Expect = 7.4 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = +2 Query: 161 ERVGSCHQTRPSCSRRKNRQTRE 229 + S + SCSR +NR+ R+ Sbjct: 225 QHTSSRYSRERSCSRDRNREYRK 247 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 20.6 bits (41), Expect = 7.4 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = +2 Query: 161 ERVGSCHQTRPSCSRRKNRQTRE 229 + S + SCSR +NR+ R+ Sbjct: 225 QHTSSRYSRERSCSRDRNREYRK 247 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 20.6 bits (41), Expect = 7.4 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = +2 Query: 161 ERVGSCHQTRPSCSRRKNRQTRE 229 + S + SCSR +NR+ R+ Sbjct: 225 QHTSSRYSRERSCSRDRNREYRK 247 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 20.6 bits (41), Expect = 7.4 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = +2 Query: 161 ERVGSCHQTRPSCSRRKNRQTRE 229 + S + SCSR +NR+ R+ Sbjct: 214 QHTSSRYSRERSCSRDRNREYRK 236 >AY352277-1|AAQ67418.1| 418|Apis mellifera complementary sex determiner protein. Length = 418 Score = 20.6 bits (41), Expect = 7.4 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = +2 Query: 161 ERVGSCHQTRPSCSRRKNRQTRE 229 + S + SCSR +NR+ R+ Sbjct: 230 QHTSSRYSRERSCSRDRNREYRK 252 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 20.6 bits (41), Expect = 7.4 Identities = 8/23 (34%), Positives = 13/23 (56%) Frame = +2 Query: 161 ERVGSCHQTRPSCSRRKNRQTRE 229 + S + SCSR +NR+ R+ Sbjct: 225 QHTSSRYSRERSCSRDRNREYRK 247 >AB194707-1|BAD69622.1| 247|Apis mellifera heme oxygenase protein. Length = 247 Score = 20.6 bits (41), Expect = 7.4 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -1 Query: 289 RAEKXINDLEFLIGKENK 236 R E DLEF +GKE K Sbjct: 78 RTEAFEVDLEFYLGKEWK 95 >DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 20.2 bits (40), Expect = 9.7 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = +2 Query: 194 SCSRRKNRQTRE 229 SCSR +NR+ +E Sbjct: 3 SCSRDRNREYKE 14 >DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 20.2 bits (40), Expect = 9.7 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = +2 Query: 194 SCSRRKNRQTRE 229 SCSR +NR+ +E Sbjct: 3 SCSRDRNREYKE 14 >DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 20.2 bits (40), Expect = 9.7 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = +2 Query: 194 SCSRRKNRQTRE 229 SCSR +NR+ +E Sbjct: 3 SCSRDRNREYKE 14 >DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 20.2 bits (40), Expect = 9.7 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = +2 Query: 194 SCSRRKNRQTRE 229 SCSR +NR+ +E Sbjct: 3 SCSRDRNREYKE 14 >DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 20.2 bits (40), Expect = 9.7 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = +2 Query: 194 SCSRRKNRQTRE 229 SCSR +NR+ +E Sbjct: 3 SCSRDRNREYKE 14 >DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 20.2 bits (40), Expect = 9.7 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = +2 Query: 194 SCSRRKNRQTRE 229 SCSR +NR+ +E Sbjct: 3 SCSRDRNREYKE 14 >DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 20.2 bits (40), Expect = 9.7 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = +2 Query: 194 SCSRRKNRQTRE 229 SCSR +NR+ +E Sbjct: 3 SCSRDRNREYKE 14 >DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 20.2 bits (40), Expect = 9.7 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = +2 Query: 194 SCSRRKNRQTRE 229 SCSR +NR+ +E Sbjct: 3 SCSRDRNREYKE 14 >DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 20.2 bits (40), Expect = 9.7 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = +2 Query: 194 SCSRRKNRQTRE 229 SCSR +NR+ +E Sbjct: 3 SCSRDRNREYKE 14 >DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 20.2 bits (40), Expect = 9.7 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = +2 Query: 194 SCSRRKNRQTRE 229 SCSR +NR+ +E Sbjct: 3 SCSRDRNREYKE 14 >DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 20.2 bits (40), Expect = 9.7 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = +2 Query: 194 SCSRRKNRQTRE 229 SCSR +NR+ +E Sbjct: 3 SCSRDRNREYKE 14 >DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 20.2 bits (40), Expect = 9.7 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = +2 Query: 194 SCSRRKNRQTRE 229 SCSR +NR+ +E Sbjct: 3 SCSRDRNREYKE 14 >DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 20.2 bits (40), Expect = 9.7 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = +2 Query: 194 SCSRRKNRQTRE 229 SCSR +NR+ +E Sbjct: 3 SCSRDRNREYKE 14 >DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 20.2 bits (40), Expect = 9.7 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = +2 Query: 194 SCSRRKNRQTRE 229 SCSR +NR+ +E Sbjct: 3 SCSRDRNREYKE 14 >DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 20.2 bits (40), Expect = 9.7 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = +2 Query: 194 SCSRRKNRQTRE 229 SCSR +NR+ +E Sbjct: 3 SCSRDRNREYKE 14 >DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex determiner protein. Length = 178 Score = 20.2 bits (40), Expect = 9.7 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = +2 Query: 194 SCSRRKNRQTRE 229 SCSR +NR+ +E Sbjct: 3 SCSRDRNREYKE 14 >DQ325082-1|ABD14096.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 20.2 bits (40), Expect = 9.7 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = +2 Query: 194 SCSRRKNRQTRE 229 SCSR +NR+ +E Sbjct: 3 SCSRDRNREYKE 14 >DQ325081-1|ABD14095.1| 186|Apis mellifera complementary sex determiner protein. Length = 186 Score = 20.2 bits (40), Expect = 9.7 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = +2 Query: 194 SCSRRKNRQTRE 229 SCSR +NR+ +E Sbjct: 3 SCSRDRNREYKE 14 >DQ325080-1|ABD14094.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 20.2 bits (40), Expect = 9.7 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = +2 Query: 194 SCSRRKNRQTRE 229 SCSR +NR+ +E Sbjct: 3 SCSRDRNREYKE 14 >DQ325079-1|ABD14093.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 20.2 bits (40), Expect = 9.7 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = +2 Query: 194 SCSRRKNRQTRE 229 SCSR +NR+ +E Sbjct: 3 SCSRDRNREYKE 14 >DQ325078-1|ABD14092.1| 184|Apis mellifera complementary sex determiner protein. Length = 184 Score = 20.2 bits (40), Expect = 9.7 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = +2 Query: 194 SCSRRKNRQTRE 229 SCSR +NR+ +E Sbjct: 3 SCSRDRNREYKE 14 >DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 20.2 bits (40), Expect = 9.7 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = +2 Query: 194 SCSRRKNRQTRE 229 SCSR +NR+ +E Sbjct: 3 SCSRDRNREYKE 14 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 92,226 Number of Sequences: 438 Number of extensions: 1708 Number of successful extensions: 70 Number of sequences better than 10.0: 70 Number of HSP's better than 10.0 without gapping: 70 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 70 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 10626762 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -