BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0464 (482 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. 23 5.5 DQ139945-1|ABA29466.1| 399|Anopheles gambiae protein O-fucosylt... 22 9.6 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 22 9.6 >AJ439353-11|CAD27933.1| 615|Anopheles gambiae 30E5.11 protein. Length = 615 Score = 23.0 bits (47), Expect = 5.5 Identities = 8/31 (25%), Positives = 17/31 (54%) Frame = -3 Query: 303 KSIDISMVKRVNHCVNSHKTSYAQNVKQIDN 211 +S+D + + NH + SH ++ ++ DN Sbjct: 217 QSVDTQTLSQANHWLKSHGDRLLEDRQRFDN 247 >DQ139945-1|ABA29466.1| 399|Anopheles gambiae protein O-fucosyltransferase 1 protein. Length = 399 Score = 22.2 bits (45), Expect = 9.6 Identities = 8/26 (30%), Positives = 18/26 (69%) Frame = -3 Query: 297 IDISMVKRVNHCVNSHKTSYAQNVKQ 220 +D++++ R NH + + +SY+ VK+ Sbjct: 339 LDLAILGRANHFIGNCISSYSAFVKR 364 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 22.2 bits (45), Expect = 9.6 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +3 Query: 210 RYLFVSHFEHSLSYVSLH 263 R LF+SH++ Y SLH Sbjct: 389 RCLFISHWQEEGVYWSLH 406 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 383,937 Number of Sequences: 2352 Number of extensions: 5417 Number of successful extensions: 7 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 42285900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -