BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0457 (482 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AM085517-1|CAJ30215.1| 339|Anopheles gambiae putative angiotens... 25 1.4 AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. 25 1.4 DQ080831-1|AAY89477.1| 170|Anopheles gambiae transcription fact... 25 1.8 DQ080830-1|AAY89476.1| 170|Anopheles gambiae transcription fact... 25 1.8 DQ080829-1|AAY89475.1| 170|Anopheles gambiae transcription fact... 25 1.8 DQ080828-1|AAY89474.1| 170|Anopheles gambiae transcription fact... 25 1.8 DQ080827-1|AAY89473.1| 170|Anopheles gambiae transcription fact... 25 1.8 DQ080826-1|AAY89472.1| 170|Anopheles gambiae transcription fact... 25 1.8 DQ080825-1|AAY89471.1| 170|Anopheles gambiae transcription fact... 25 1.8 DQ080824-1|AAY89470.1| 170|Anopheles gambiae transcription fact... 25 1.8 DQ080823-1|AAY89469.1| 170|Anopheles gambiae transcription fact... 25 1.8 DQ080822-1|AAY89468.1| 170|Anopheles gambiae transcription fact... 25 1.8 DQ080821-1|AAY89467.1| 170|Anopheles gambiae transcription fact... 25 1.8 DQ080820-1|AAY89466.1| 170|Anopheles gambiae transcription fact... 25 1.8 DQ080819-1|AAY89465.1| 170|Anopheles gambiae transcription fact... 25 1.8 DQ080818-1|AAY89464.1| 170|Anopheles gambiae transcription fact... 25 1.8 DQ080817-1|AAY89463.1| 170|Anopheles gambiae transcription fact... 25 1.8 DQ080816-1|AAY89462.1| 170|Anopheles gambiae transcription fact... 25 1.8 DQ080815-1|AAY89461.1| 170|Anopheles gambiae transcription fact... 25 1.8 DQ080814-1|AAY89460.1| 170|Anopheles gambiae transcription fact... 25 1.8 DQ080813-1|AAY89459.1| 170|Anopheles gambiae transcription fact... 25 1.8 DQ080812-1|AAY89458.1| 170|Anopheles gambiae transcription fact... 25 1.8 DQ080811-1|AAY89457.1| 170|Anopheles gambiae transcription fact... 25 1.8 DQ080810-1|AAY89456.1| 170|Anopheles gambiae transcription fact... 25 1.8 DQ080809-1|AAY89455.1| 170|Anopheles gambiae transcription fact... 25 1.8 DQ080808-1|AAY89454.1| 170|Anopheles gambiae transcription fact... 25 1.8 DQ080807-1|AAY89453.1| 154|Anopheles gambiae transcription fact... 25 1.8 DQ080806-1|AAY89452.1| 154|Anopheles gambiae transcription fact... 25 1.8 DQ080805-1|AAY89451.1| 170|Anopheles gambiae transcription fact... 25 1.8 DQ080804-1|AAY89450.1| 170|Anopheles gambiae transcription fact... 25 1.8 DQ080803-1|AAY89449.1| 170|Anopheles gambiae transcription fact... 25 1.8 DQ080802-1|AAY89448.1| 170|Anopheles gambiae transcription fact... 25 1.8 DQ080801-1|AAY89447.1| 170|Anopheles gambiae transcription fact... 25 1.8 DQ080800-1|AAY89446.1| 170|Anopheles gambiae transcription fact... 25 1.8 DQ080799-1|AAY89445.1| 170|Anopheles gambiae transcription fact... 25 1.8 DQ080798-1|AAY89444.1| 170|Anopheles gambiae transcription fact... 25 1.8 DQ080797-1|AAY89443.1| 170|Anopheles gambiae transcription fact... 25 1.8 DQ080796-1|AAY89442.1| 170|Anopheles gambiae transcription fact... 25 1.8 DQ080795-1|AAY89441.1| 170|Anopheles gambiae transcription fact... 25 1.8 DQ080794-1|AAY89440.1| 170|Anopheles gambiae transcription fact... 25 1.8 DQ080793-1|AAY89439.1| 170|Anopheles gambiae transcription fact... 25 1.8 DQ080792-1|AAY89438.1| 170|Anopheles gambiae transcription fact... 25 1.8 DQ080791-1|AAY89437.1| 170|Anopheles gambiae transcription fact... 25 1.8 DQ080790-1|AAY89436.1| 170|Anopheles gambiae transcription fact... 25 1.8 DQ080789-1|AAY89435.1| 170|Anopheles gambiae transcription fact... 25 1.8 DQ080788-1|AAY89434.1| 170|Anopheles gambiae transcription fact... 25 1.8 AY462096-1|AAS21248.1| 603|Anopheles gambiae transposase protein. 25 1.8 AY146758-1|AAO12073.1| 289|Anopheles gambiae odorant-binding pr... 24 3.1 AY146755-1|AAO12070.1| 320|Anopheles gambiae odorant-binding pr... 24 3.1 AY146754-1|AAO12069.1| 334|Anopheles gambiae odorant-binding pr... 24 3.1 AJ618930-1|CAF02010.2| 273|Anopheles gambiae odorant-binding pr... 24 3.1 AF393485-1|AAL60410.1| 289|Anopheles gambiae odorant binding pr... 24 3.1 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 22 9.6 CR954257-10|CAJ14161.1| 519|Anopheles gambiae Sply, Sphingosine... 22 9.6 AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoi... 22 9.6 >AM085517-1|CAJ30215.1| 339|Anopheles gambiae putative angiotensin converting enzymeprecursor protein. Length = 339 Score = 25.0 bits (52), Expect = 1.4 Identities = 29/119 (24%), Positives = 50/119 (42%) Frame = +2 Query: 62 NHPFRKFIGYCNDYDRDMRKCLKAERLQRQKANLDESRQRHANIRARILAQSAAAN*YIF 241 N+P ++ G NDYDR R+ R + D R+ N R R + N Y+ Sbjct: 95 NYPAQQPEGRANDYDRRDRQDSPYSYNDRNRYGGDRGYDRNQN-RER-YPGDRSPNPYVS 152 Query: 242 KLENKFCDYENNGFQHSRFNTRLRQSEDLHREILFKTILN*CRWHKK**YDDNVSFKPN 418 ++N Y + G ++ R R D+ +L++ + ++ YDD + PN Sbjct: 153 DVDNPLL-YRDGGDRN-----RNRYVSDVENPLLYR---DRTPYNPSRDYDDRNRYNPN 202 >AJ535208-1|CAD59408.1| 1133|Anopheles gambiae SMC6 protein protein. Length = 1133 Score = 25.0 bits (52), Expect = 1.4 Identities = 11/40 (27%), Positives = 19/40 (47%) Frame = +3 Query: 270 KTMDFNILDSIPDLDNLKTFTERYFSKRYLINVDGIKNND 389 +T+D + PDL N FT R+ + Y + ++ D Sbjct: 581 RTLDALLKREFPDLQNRTIFTGRFVKELYDVRSGCVQEQD 620 >DQ080831-1|AAY89477.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.6 bits (51), Expect = 1.8 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 Query: 32 FIKKLVDCHLNHPFRKFI 85 F +D +LNHP RK+I Sbjct: 47 FYTPALDYYLNHPIRKYI 64 >DQ080830-1|AAY89476.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.6 bits (51), Expect = 1.8 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 Query: 32 FIKKLVDCHLNHPFRKFI 85 F +D +LNHP RK+I Sbjct: 47 FYTPALDYYLNHPIRKYI 64 >DQ080829-1|AAY89475.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.6 bits (51), Expect = 1.8 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 Query: 32 FIKKLVDCHLNHPFRKFI 85 F +D +LNHP RK+I Sbjct: 47 FYTPALDYYLNHPIRKYI 64 >DQ080828-1|AAY89474.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.6 bits (51), Expect = 1.8 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 Query: 32 FIKKLVDCHLNHPFRKFI 85 F +D +LNHP RK+I Sbjct: 47 FYTPALDYYLNHPIRKYI 64 >DQ080827-1|AAY89473.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.6 bits (51), Expect = 1.8 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 Query: 32 FIKKLVDCHLNHPFRKFI 85 F +D +LNHP RK+I Sbjct: 47 FYTPALDYYLNHPIRKYI 64 >DQ080826-1|AAY89472.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.6 bits (51), Expect = 1.8 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 Query: 32 FIKKLVDCHLNHPFRKFI 85 F +D +LNHP RK+I Sbjct: 47 FYTPALDYYLNHPIRKYI 64 >DQ080825-1|AAY89471.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.6 bits (51), Expect = 1.8 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 Query: 32 FIKKLVDCHLNHPFRKFI 85 F +D +LNHP RK+I Sbjct: 47 FYTPALDYYLNHPIRKYI 64 >DQ080824-1|AAY89470.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.6 bits (51), Expect = 1.8 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 Query: 32 FIKKLVDCHLNHPFRKFI 85 F +D +LNHP RK+I Sbjct: 47 FYTPALDYYLNHPIRKYI 64 >DQ080823-1|AAY89469.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.6 bits (51), Expect = 1.8 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 Query: 32 FIKKLVDCHLNHPFRKFI 85 F +D +LNHP RK+I Sbjct: 47 FYTPALDYYLNHPIRKYI 64 >DQ080822-1|AAY89468.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.6 bits (51), Expect = 1.8 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 Query: 32 FIKKLVDCHLNHPFRKFI 85 F +D +LNHP RK+I Sbjct: 47 FYTPALDYYLNHPIRKYI 64 >DQ080821-1|AAY89467.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.6 bits (51), Expect = 1.8 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 Query: 32 FIKKLVDCHLNHPFRKFI 85 F +D +LNHP RK+I Sbjct: 47 FYTPALDYYLNHPIRKYI 64 >DQ080820-1|AAY89466.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.6 bits (51), Expect = 1.8 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 Query: 32 FIKKLVDCHLNHPFRKFI 85 F +D +LNHP RK+I Sbjct: 47 FYTPALDYYLNHPIRKYI 64 >DQ080819-1|AAY89465.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.6 bits (51), Expect = 1.8 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 Query: 32 FIKKLVDCHLNHPFRKFI 85 F +D +LNHP RK+I Sbjct: 47 FYTPALDYYLNHPIRKYI 64 >DQ080818-1|AAY89464.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.6 bits (51), Expect = 1.8 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 Query: 32 FIKKLVDCHLNHPFRKFI 85 F +D +LNHP RK+I Sbjct: 47 FYTPALDYYLNHPIRKYI 64 >DQ080817-1|AAY89463.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.6 bits (51), Expect = 1.8 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 Query: 32 FIKKLVDCHLNHPFRKFI 85 F +D +LNHP RK+I Sbjct: 47 FYTPALDYYLNHPIRKYI 64 >DQ080816-1|AAY89462.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.6 bits (51), Expect = 1.8 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 Query: 32 FIKKLVDCHLNHPFRKFI 85 F +D +LNHP RK+I Sbjct: 47 FYTPALDYYLNHPIRKYI 64 >DQ080815-1|AAY89461.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.6 bits (51), Expect = 1.8 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 Query: 32 FIKKLVDCHLNHPFRKFI 85 F +D +LNHP RK+I Sbjct: 47 FYTPALDYYLNHPIRKYI 64 >DQ080814-1|AAY89460.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.6 bits (51), Expect = 1.8 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 Query: 32 FIKKLVDCHLNHPFRKFI 85 F +D +LNHP RK+I Sbjct: 47 FYTPALDYYLNHPIRKYI 64 >DQ080813-1|AAY89459.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.6 bits (51), Expect = 1.8 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 Query: 32 FIKKLVDCHLNHPFRKFI 85 F +D +LNHP RK+I Sbjct: 47 FYTPALDYYLNHPIRKYI 64 >DQ080812-1|AAY89458.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.6 bits (51), Expect = 1.8 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 Query: 32 FIKKLVDCHLNHPFRKFI 85 F +D +LNHP RK+I Sbjct: 47 FYTPALDYYLNHPIRKYI 64 >DQ080811-1|AAY89457.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.6 bits (51), Expect = 1.8 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 Query: 32 FIKKLVDCHLNHPFRKFI 85 F +D +LNHP RK+I Sbjct: 47 FYTPALDYYLNHPIRKYI 64 >DQ080810-1|AAY89456.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.6 bits (51), Expect = 1.8 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 Query: 32 FIKKLVDCHLNHPFRKFI 85 F +D +LNHP RK+I Sbjct: 47 FYTPALDYYLNHPIRKYI 64 >DQ080809-1|AAY89455.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.6 bits (51), Expect = 1.8 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 Query: 32 FIKKLVDCHLNHPFRKFI 85 F +D +LNHP RK+I Sbjct: 47 FYTPALDYYLNHPIRKYI 64 >DQ080808-1|AAY89454.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.6 bits (51), Expect = 1.8 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 Query: 32 FIKKLVDCHLNHPFRKFI 85 F +D +LNHP RK+I Sbjct: 47 FYTPALDYYLNHPIRKYI 64 >DQ080807-1|AAY89453.1| 154|Anopheles gambiae transcription factor 3C protein. Length = 154 Score = 24.6 bits (51), Expect = 1.8 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 Query: 32 FIKKLVDCHLNHPFRKFI 85 F +D +LNHP RK+I Sbjct: 36 FYTPALDYYLNHPIRKYI 53 >DQ080806-1|AAY89452.1| 154|Anopheles gambiae transcription factor 3C protein. Length = 154 Score = 24.6 bits (51), Expect = 1.8 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 Query: 32 FIKKLVDCHLNHPFRKFI 85 F +D +LNHP RK+I Sbjct: 36 FYTPALDYYLNHPIRKYI 53 >DQ080805-1|AAY89451.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.6 bits (51), Expect = 1.8 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 Query: 32 FIKKLVDCHLNHPFRKFI 85 F +D +LNHP RK+I Sbjct: 47 FYTPALDYYLNHPIRKYI 64 >DQ080804-1|AAY89450.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.6 bits (51), Expect = 1.8 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 Query: 32 FIKKLVDCHLNHPFRKFI 85 F +D +LNHP RK+I Sbjct: 47 FYTPALDYYLNHPIRKYI 64 >DQ080803-1|AAY89449.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.6 bits (51), Expect = 1.8 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 Query: 32 FIKKLVDCHLNHPFRKFI 85 F +D +LNHP RK+I Sbjct: 47 FYTPALDYYLNHPIRKYI 64 >DQ080802-1|AAY89448.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.6 bits (51), Expect = 1.8 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 Query: 32 FIKKLVDCHLNHPFRKFI 85 F +D +LNHP RK+I Sbjct: 47 FYTPALDYYLNHPIRKYI 64 >DQ080801-1|AAY89447.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.6 bits (51), Expect = 1.8 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 Query: 32 FIKKLVDCHLNHPFRKFI 85 F +D +LNHP RK+I Sbjct: 47 FYTPALDYYLNHPIRKYI 64 >DQ080800-1|AAY89446.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.6 bits (51), Expect = 1.8 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 Query: 32 FIKKLVDCHLNHPFRKFI 85 F +D +LNHP RK+I Sbjct: 47 FYTPALDYYLNHPIRKYI 64 >DQ080799-1|AAY89445.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.6 bits (51), Expect = 1.8 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 Query: 32 FIKKLVDCHLNHPFRKFI 85 F +D +LNHP RK+I Sbjct: 47 FYTPALDYYLNHPIRKYI 64 >DQ080798-1|AAY89444.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.6 bits (51), Expect = 1.8 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 Query: 32 FIKKLVDCHLNHPFRKFI 85 F +D +LNHP RK+I Sbjct: 47 FYTPALDYYLNHPIRKYI 64 >DQ080797-1|AAY89443.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.6 bits (51), Expect = 1.8 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 Query: 32 FIKKLVDCHLNHPFRKFI 85 F +D +LNHP RK+I Sbjct: 47 FYTPALDYYLNHPIRKYI 64 >DQ080796-1|AAY89442.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.6 bits (51), Expect = 1.8 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 Query: 32 FIKKLVDCHLNHPFRKFI 85 F +D +LNHP RK+I Sbjct: 47 FYTPALDYYLNHPIRKYI 64 >DQ080795-1|AAY89441.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.6 bits (51), Expect = 1.8 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 Query: 32 FIKKLVDCHLNHPFRKFI 85 F +D +LNHP RK+I Sbjct: 47 FYTPALDYYLNHPIRKYI 64 >DQ080794-1|AAY89440.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.6 bits (51), Expect = 1.8 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 Query: 32 FIKKLVDCHLNHPFRKFI 85 F +D +LNHP RK+I Sbjct: 47 FYTPALDYYLNHPIRKYI 64 >DQ080793-1|AAY89439.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.6 bits (51), Expect = 1.8 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 Query: 32 FIKKLVDCHLNHPFRKFI 85 F +D +LNHP RK+I Sbjct: 47 FYTPALDYYLNHPIRKYI 64 >DQ080792-1|AAY89438.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.6 bits (51), Expect = 1.8 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 Query: 32 FIKKLVDCHLNHPFRKFI 85 F +D +LNHP RK+I Sbjct: 47 FYTPALDYYLNHPIRKYI 64 >DQ080791-1|AAY89437.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.6 bits (51), Expect = 1.8 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 Query: 32 FIKKLVDCHLNHPFRKFI 85 F +D +LNHP RK+I Sbjct: 47 FYTPALDYYLNHPIRKYI 64 >DQ080790-1|AAY89436.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.6 bits (51), Expect = 1.8 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 Query: 32 FIKKLVDCHLNHPFRKFI 85 F +D +LNHP RK+I Sbjct: 47 FYTPALDYYLNHPIRKYI 64 >DQ080789-1|AAY89435.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.6 bits (51), Expect = 1.8 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 Query: 32 FIKKLVDCHLNHPFRKFI 85 F +D +LNHP RK+I Sbjct: 47 FYTPALDYYLNHPIRKYI 64 >DQ080788-1|AAY89434.1| 170|Anopheles gambiae transcription factor 3C protein. Length = 170 Score = 24.6 bits (51), Expect = 1.8 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 Query: 32 FIKKLVDCHLNHPFRKFI 85 F +D +LNHP RK+I Sbjct: 47 FYTPALDYYLNHPIRKYI 64 >AY462096-1|AAS21248.1| 603|Anopheles gambiae transposase protein. Length = 603 Score = 24.6 bits (51), Expect = 1.8 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = +3 Query: 387 DMMIMFHSNRIALLSLAPS 443 DM+ F+ N+IALLS A S Sbjct: 334 DMLNRFYKNKIALLSCADS 352 >AY146758-1|AAO12073.1| 289|Anopheles gambiae odorant-binding protein AgamOBP30 protein. Length = 289 Score = 23.8 bits (49), Expect = 3.1 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +2 Query: 98 DYDRDMRKCLKAERLQRQKANLDESRQR 181 DY+R +CL ++RL R A DE+ +R Sbjct: 120 DYERRTYRCLHSQRLDR-PAPHDEACER 146 >AY146755-1|AAO12070.1| 320|Anopheles gambiae odorant-binding protein AgamOBP32 protein. Length = 320 Score = 23.8 bits (49), Expect = 3.1 Identities = 9/33 (27%), Positives = 17/33 (51%) Frame = +2 Query: 98 DYDRDMRKCLKAERLQRQKANLDESRQRHANIR 196 DY+R CL ++RL ++D + + + R Sbjct: 104 DYERRTYHCLNSQRLNHPSPHVDVCERAYESFR 136 >AY146754-1|AAO12069.1| 334|Anopheles gambiae odorant-binding protein AgamOBP33 protein. Length = 334 Score = 23.8 bits (49), Expect = 3.1 Identities = 9/33 (27%), Positives = 17/33 (51%) Frame = +2 Query: 98 DYDRDMRKCLKAERLQRQKANLDESRQRHANIR 196 DY+R CL ++RL ++D + + + R Sbjct: 104 DYERRTYHCLNSQRLNHPSPHVDVCERAYESFR 136 >AJ618930-1|CAF02010.2| 273|Anopheles gambiae odorant-binding protein OBPjj83c protein. Length = 273 Score = 23.8 bits (49), Expect = 3.1 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +2 Query: 98 DYDRDMRKCLKAERLQRQKANLDESRQR 181 DY+R +CL ++RL R A DE+ +R Sbjct: 104 DYERRTYRCLHSQRLDR-PAPHDEACER 130 >AF393485-1|AAL60410.1| 289|Anopheles gambiae odorant binding protein 1 protein. Length = 289 Score = 23.8 bits (49), Expect = 3.1 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = +2 Query: 98 DYDRDMRKCLKAERLQRQKANLDESRQR 181 DY+R +CL ++RL R A DE+ +R Sbjct: 120 DYERRTYRCLHSQRLDR-PAPHDEACER 146 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 22.2 bits (45), Expect = 9.6 Identities = 7/17 (41%), Positives = 13/17 (76%) Frame = -2 Query: 133 SFQTFPHVAIIIIAITY 83 SFQ P+VA++I+ + + Sbjct: 1305 SFQALPYVALLIVMLFF 1321 >CR954257-10|CAJ14161.1| 519|Anopheles gambiae Sply, Sphingosine-phosphate lyase protein. Length = 519 Score = 22.2 bits (45), Expect = 9.6 Identities = 8/30 (26%), Positives = 15/30 (50%) Frame = +3 Query: 282 FNILDSIPDLDNLKTFTERYFSKRYLINVD 371 + + S+PD + + FT+ + Y VD Sbjct: 485 YGVAQSVPDRELIGDFTKCFIDSMYYTPVD 514 >AJ439353-8|CAD27930.1| 1039|Anopheles gambiae putative DNA topoisomerase protein. Length = 1039 Score = 22.2 bits (45), Expect = 9.6 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -2 Query: 205 NSCSNIGVALSRF 167 N+CSN+GV L F Sbjct: 453 NACSNLGVLLIEF 465 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 445,167 Number of Sequences: 2352 Number of extensions: 8488 Number of successful extensions: 61 Number of sequences better than 10.0: 55 Number of HSP's better than 10.0 without gapping: 61 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 61 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 42285900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -