BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0457 (482 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY069582-1|AAL39727.1| 214|Drosophila melanogaster LD32260p pro... 31 0.63 AE014297-1760|AAF54989.1| 214|Drosophila melanogaster CG9288-PA... 31 0.63 >AY069582-1|AAL39727.1| 214|Drosophila melanogaster LD32260p protein. Length = 214 Score = 31.5 bits (68), Expect = 0.63 Identities = 14/45 (31%), Positives = 25/45 (55%) Frame = +3 Query: 312 DNLKTFTERYFSKRYLINVDGIKNNDMMIMFHSNRIALLSLAPSH 446 ++ + +R+F++ Y D +++HSNRI L+ LAP H Sbjct: 35 EDYPSVVDRFFTRYYYFKGDV----PYQVLYHSNRICLICLAPEH 75 >AE014297-1760|AAF54989.1| 214|Drosophila melanogaster CG9288-PA protein. Length = 214 Score = 31.5 bits (68), Expect = 0.63 Identities = 14/45 (31%), Positives = 25/45 (55%) Frame = +3 Query: 312 DNLKTFTERYFSKRYLINVDGIKNNDMMIMFHSNRIALLSLAPSH 446 ++ + +R+F++ Y D +++HSNRI L+ LAP H Sbjct: 35 EDYPSVVDRFFTRYYYFKGDV----PYQVLYHSNRICLICLAPEH 75 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,640,186 Number of Sequences: 53049 Number of extensions: 334388 Number of successful extensions: 760 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 742 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 760 length of database: 24,988,368 effective HSP length: 79 effective length of database: 20,797,497 effective search space used: 1684597257 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -