BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0454 (487 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z78419-4|CAB01700.1| 226|Caenorhabditis elegans Hypothetical pr... 29 1.4 Z46266-1|CAA86409.1| 116|Caenorhabditis elegans Hypothetical pr... 27 5.5 Z92972-7|CAB07486.1| 402|Caenorhabditis elegans Hypothetical pr... 27 9.5 >Z78419-4|CAB01700.1| 226|Caenorhabditis elegans Hypothetical protein F26A3.4 protein. Length = 226 Score = 29.5 bits (63), Expect = 1.4 Identities = 13/47 (27%), Positives = 24/47 (51%) Frame = -3 Query: 482 KIYRHIMSNLNKNAGMFCRTRKSRYRCHKNKSLSHLFKKDSDISRPN 342 K+ H ++ ++++A + C +YRC + HL K + RPN Sbjct: 93 KVLVHCVAGVSRSASI-CLAFLLKYRCRNLREAYHLMKSKRSMVRPN 138 >Z46266-1|CAA86409.1| 116|Caenorhabditis elegans Hypothetical protein C07B5.2 protein. Length = 116 Score = 27.5 bits (58), Expect = 5.5 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = -3 Query: 455 LNKNAGMFCRTRKSRYRCHKNKSLSHLFKKDSDISRPNC 339 L+KN G+F R + + H + SL H K ++ PNC Sbjct: 69 LSKNTGVFNREKYKAFLDHVHLSLEHC-NKAAENPYPNC 106 >Z92972-7|CAB07486.1| 402|Caenorhabditis elegans Hypothetical protein T19C9.8 protein. Length = 402 Score = 26.6 bits (56), Expect = 9.5 Identities = 9/25 (36%), Positives = 16/25 (64%), Gaps = 1/25 (4%) Frame = +2 Query: 389 FCFYD-IYIGFSLCDRTCPHFYLSL 460 +C D ++GF +CD T P Y+++ Sbjct: 40 YCLLDKFFLGFGVCDDTYPTLYVNI 64 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,358,620 Number of Sequences: 27780 Number of extensions: 172404 Number of successful extensions: 242 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 239 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 242 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 903458030 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -