BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0447 (489 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL031627-14|CAA20965.1| 234|Caenorhabditis elegans Hypothetical... 28 4.2 AL031627-12|CAA20963.2| 305|Caenorhabditis elegans Hypothetical... 28 4.2 U70858-9|AAB09181.2| 300|Caenorhabditis elegans Serpentine rece... 27 5.5 AF003142-1|AAB54189.2| 389|Caenorhabditis elegans Hypothetical ... 27 5.5 AL132943-9|CAB81982.1| 233|Caenorhabditis elegans Hypothetical ... 27 7.3 AC006615-5|AAK68229.1| 97|Caenorhabditis elegans Hypothetical ... 27 7.3 Z77132-6|CAB00861.3| 1406|Caenorhabditis elegans Hypothetical pr... 27 9.7 U41007-17|AAA82261.1| 507|Caenorhabditis elegans Hypothetical p... 27 9.7 AJ276018-1|CAC81666.1| 1122|Caenorhabditis elegans putative TRP ... 27 9.7 >AL031627-14|CAA20965.1| 234|Caenorhabditis elegans Hypothetical protein Y102A5C.24 protein. Length = 234 Score = 27.9 bits (59), Expect = 4.2 Identities = 17/54 (31%), Positives = 30/54 (55%) Frame = +2 Query: 239 NRFS*LVNPISFPSIFAWTQLKVLLRFNLTFIVSIRLLSTFEYIFISVTRCYSW 400 NRF +V P+ + SIF+ + L+ F+ T + +L +F Y+++ YSW Sbjct: 30 NRFCSIVAPVRYESIFSASNTTKLIIFSWT----LTILPSF-YLYVYNDCKYSW 78 >AL031627-12|CAA20963.2| 305|Caenorhabditis elegans Hypothetical protein Y102A5C.22 protein. Length = 305 Score = 27.9 bits (59), Expect = 4.2 Identities = 17/54 (31%), Positives = 30/54 (55%) Frame = +2 Query: 239 NRFS*LVNPISFPSIFAWTQLKVLLRFNLTFIVSIRLLSTFEYIFISVTRCYSW 400 NRF +V P+ + SIF+ + L+ F+ T + +L +F Y+++ YSW Sbjct: 101 NRFCSIVAPVRYESIFSASNTTKLIIFSWT----LTILPSF-YLYVYNDCKYSW 149 >U70858-9|AAB09181.2| 300|Caenorhabditis elegans Serpentine receptor, class x protein36 protein. Length = 300 Score = 27.5 bits (58), Expect = 5.5 Identities = 14/45 (31%), Positives = 28/45 (62%) Frame = +2 Query: 239 NRFS*LVNPISFPSIFAWTQLKVLLRFNLTFIVSIRLLSTFEYIF 373 NRF + PI++ ++ + T+ KV++ F +FI+S+ L+ I+ Sbjct: 100 NRFCAVFLPIAYKTLLSSTRTKVIIAF--SFILSLAFLTILFQIY 142 >AF003142-1|AAB54189.2| 389|Caenorhabditis elegans Hypothetical protein F57C9.6 protein. Length = 389 Score = 27.5 bits (58), Expect = 5.5 Identities = 16/32 (50%), Positives = 22/32 (68%), Gaps = 1/32 (3%) Frame = +2 Query: 305 VLLRF-NLTFIVSIRLLSTFEYIFISVTRCYS 397 VLLRF NLT I+++ L++ E+IFI YS Sbjct: 127 VLLRFTNLTTIMNVLLITMNEFIFICHPLRYS 158 >AL132943-9|CAB81982.1| 233|Caenorhabditis elegans Hypothetical protein Y116F11B.13 protein. Length = 233 Score = 27.1 bits (57), Expect = 7.3 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = -3 Query: 286 ENRRKRNWINELTKSILLKSKNNRRCYY 203 E + K+NW E ++ SKN R Y+ Sbjct: 194 EKQEKKNWEEEYDLILIFNSKNQLRTYF 221 >AC006615-5|AAK68229.1| 97|Caenorhabditis elegans Hypothetical protein C36B7.3 protein. Length = 97 Score = 27.1 bits (57), Expect = 7.3 Identities = 11/32 (34%), Positives = 19/32 (59%) Frame = +3 Query: 57 EHTCQANERRVQDILVCLQNCPTQKRQPSKFH 152 EH+ + E + + +C+++ P QKR P FH Sbjct: 52 EHSSECLEGLICEKQICIES-PIQKRHPRSFH 82 >Z77132-6|CAB00861.3| 1406|Caenorhabditis elegans Hypothetical protein F54D1.5 protein. Length = 1406 Score = 26.6 bits (56), Expect = 9.7 Identities = 18/66 (27%), Positives = 26/66 (39%), Gaps = 2/66 (3%) Frame = +2 Query: 272 FPSIFAWTQLKVLLRFNLTFIVSIRLLSTFEYIFI-SVTRCYS-WKFQNYSDYRRYHKIK 445 FP F L V+ ++ L++ F I+ S+ + W FQ Y YH Sbjct: 1100 FPGYFIPPLLMVIFLLVANILLLNLLIAIFNNIYNDSIEKSKEIWLFQRYQQLMEYHDSP 1159 Query: 446 ILSPRF 463 L P F Sbjct: 1160 FLPPPF 1165 >U41007-17|AAA82261.1| 507|Caenorhabditis elegans Hypothetical protein C33H5.2 protein. Length = 507 Score = 26.6 bits (56), Expect = 9.7 Identities = 13/38 (34%), Positives = 18/38 (47%) Frame = +2 Query: 350 LSTFEYIFISVTRCYSWKFQNYSDYRRYHKIKILSPRF 463 L Y V +CY+ KF +Y RY KI P++ Sbjct: 424 LPKIRYYSDLVLKCYNEKFYDYFYSGRYEKITCPGPQY 461 >AJ276018-1|CAC81666.1| 1122|Caenorhabditis elegans putative TRP homologous cationchannel protein. Length = 1122 Score = 26.6 bits (56), Expect = 9.7 Identities = 18/66 (27%), Positives = 26/66 (39%), Gaps = 2/66 (3%) Frame = +2 Query: 272 FPSIFAWTQLKVLLRFNLTFIVSIRLLSTFEYIFI-SVTRCYS-WKFQNYSDYRRYHKIK 445 FP F L V+ ++ L++ F I+ S+ + W FQ Y YH Sbjct: 816 FPGYFIPPLLMVIFLLVANILLLNLLIAIFNNIYNDSIEKSKEIWLFQRYQQLMEYHDSP 875 Query: 446 ILSPRF 463 L P F Sbjct: 876 FLPPPF 881 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,527,666 Number of Sequences: 27780 Number of extensions: 209477 Number of successful extensions: 594 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 582 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 594 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 914086948 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -