BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0443 (332 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_P61081 Cluster: NEDD8-conjugating enzyme Ubc12; n=24; E... 159 9e-39 UniRef50_Q4SUR6 Cluster: Ubiquitin carrier protein; n=1; Tetraod... 152 2e-36 UniRef50_A5DY26 Cluster: Ubiquitin carrier protein; n=3; Sacchar... 111 3e-24 UniRef50_A6RUK1 Cluster: Ubiquitin carrier protein; n=2; Sclerot... 110 5e-24 UniRef50_Q6C9W0 Cluster: NEDD8-conjugating enzyme UBC12; n=41; E... 107 6e-23 UniRef50_Q54TI6 Cluster: Ubiquitin carrier protein; n=1; Dictyos... 105 3e-22 UniRef50_Q5A7Q5 Cluster: Ubiquitin carrier protein; n=2; Ascomyc... 103 1e-21 UniRef50_Q247Y5 Cluster: Ubiquitin carrier protein; n=1; Tetrahy... 101 2e-21 UniRef50_O74549 Cluster: NEDD8-conjugating enzyme ubc12; n=10; D... 99 1e-20 UniRef50_Q8R352 Cluster: Ube2m protein; n=1; Mus musculus|Rep: U... 95 3e-19 UniRef50_A7TRY4 Cluster: Putative uncharacterized protein; n=1; ... 89 2e-17 UniRef50_P52491 Cluster: NEDD8-conjugating enzyme UBC12; n=3; Sa... 89 2e-17 UniRef50_Q75AF2 Cluster: NEDD8-conjugating enzyme UBC12; n=2; Er... 89 2e-17 UniRef50_A0EBF3 Cluster: Ubiquitin carrier protein; n=1; Paramec... 85 2e-16 UniRef50_Q6CSW8 Cluster: NEDD8-conjugating enzyme UBC12; n=1; Kl... 84 7e-16 UniRef50_UPI000049916F Cluster: ubiquitin-conjugating enzyme; n=... 77 8e-14 UniRef50_A6RGW5 Cluster: Ubiquitin carrier protein; n=1; Ajellom... 76 2e-13 UniRef50_A2E5I6 Cluster: Ubiquitin carrier protein; n=1; Trichom... 73 2e-12 UniRef50_A2EGV7 Cluster: Ubiquitin carrier protein; n=1; Trichom... 71 4e-12 UniRef50_A3FQP7 Cluster: Ubiquitin carrier protein; n=2; Cryptos... 64 8e-10 UniRef50_A2E403 Cluster: Ubiquitin carrier protein; n=1; Trichom... 63 1e-09 UniRef50_A2DXW4 Cluster: Ubiquitin carrier protein; n=2; Trichom... 62 2e-09 UniRef50_A7ARW5 Cluster: Putative uncharacterized protein; n=1; ... 62 3e-09 UniRef50_A2F2A5 Cluster: Ubiquitin carrier protein; n=1; Trichom... 60 1e-08 UniRef50_Q4RS31 Cluster: Ubiquitin carrier protein; n=1; Tetraod... 59 2e-08 UniRef50_Q4Y3H7 Cluster: Ubiquitin carrier protein; n=1; Plasmod... 59 2e-08 UniRef50_Q4UI29 Cluster: Ubiquitin-conjugating enzyme E2 (RUB1 h... 59 2e-08 UniRef50_A6NGR2 Cluster: Uncharacterized protein UBE2A (Ubiquiti... 59 2e-08 UniRef50_P63146 Cluster: Ubiquitin-conjugating enzyme E2 B; n=55... 59 2e-08 UniRef50_A2EJF5 Cluster: Ubiquitin-conjugating enzyme family pro... 59 2e-08 UniRef50_Q7QVV7 Cluster: Ubiquitin carrier protein; n=1; Giardia... 58 3e-08 UniRef50_Q4DY64 Cluster: Ubiquitin-conjugating enzyme E2, putati... 58 4e-08 UniRef50_A2YZH4 Cluster: Ubiquitin carrier protein; n=3; Spermat... 58 5e-08 UniRef50_Q8WXB3 Cluster: Ubiquitin carrier protein; n=8; Bilater... 58 5e-08 UniRef50_P25153 Cluster: Ubiquitin-conjugating enzyme E2-17 kDa;... 58 5e-08 UniRef50_Q4WNS9 Cluster: Ubiquitin carrier protein; n=4; Ascomyc... 57 7e-08 UniRef50_Q9C8X7 Cluster: Putative ubiquitin conjugating enzyme; ... 56 2e-07 UniRef50_Q8I4X8 Cluster: Ubiquitin carrier protein; n=2; Plasmod... 56 2e-07 UniRef50_A6NLF6 Cluster: Ubiquitin carrier protein; n=4; Eutheri... 56 2e-07 UniRef50_Q8SQR1 Cluster: Ubiquitin carrier protein; n=1; Encepha... 56 2e-07 UniRef50_A2YII6 Cluster: Ubiquitin carrier protein; n=5; Eukaryo... 56 2e-07 UniRef50_Q9I7T6 Cluster: Ubiquitin carrier protein; n=5; Eukaryo... 56 2e-07 UniRef50_A0CH05 Cluster: Chromosome undetermined scaffold_18, wh... 56 2e-07 UniRef50_A6NP33 Cluster: Uncharacterized protein UBE2C; n=14; Th... 56 2e-07 UniRef50_O00762 Cluster: Ubiquitin-conjugating enzyme E2 C; n=26... 56 2e-07 UniRef50_P56616 Cluster: Ubiquitin-conjugating enzyme E2 C; n=20... 55 3e-07 UniRef50_A0E1Q4 Cluster: Ubiquitin carrier protein; n=6; Eukaryo... 55 4e-07 UniRef50_P35132 Cluster: SUMO-conjugating enzyme UBC9; n=75; Euk... 54 5e-07 UniRef50_Q7QT23 Cluster: Ubiquitin carrier protein; n=1; Giardia... 54 8e-07 UniRef50_A0E347 Cluster: Ubiquitin carrier protein; n=4; Eukaryo... 54 8e-07 UniRef50_Q7RY50 Cluster: Putative uncharacterized protein NCU045... 54 8e-07 UniRef50_P61088 Cluster: Ubiquitin-conjugating enzyme E2 N; n=12... 53 1e-06 UniRef50_P63279 Cluster: SUMO-conjugating enzyme UBC9; n=74; Euk... 53 1e-06 UniRef50_UPI0000F2B380 Cluster: PREDICTED: similar to Chain B, C... 52 2e-06 UniRef50_Q54IK3 Cluster: Ubiquitin carrier protein; n=1; Dictyos... 52 2e-06 UniRef50_Q4YK13 Cluster: Ubiquitin carrier protein; n=2; Alveola... 52 2e-06 UniRef50_P62837 Cluster: Ubiquitin-conjugating enzyme E2 D2 (EC ... 52 2e-06 UniRef50_Q7KNM2 Cluster: Ubiquitin carrier protein; n=39; Eukary... 52 3e-06 UniRef50_Q0UIW0 Cluster: Putative uncharacterized protein; n=1; ... 52 3e-06 UniRef50_Q5UQC9 Cluster: Probable ubiquitin-conjugating enzyme E... 52 3e-06 UniRef50_UPI0000ECA0A1 Cluster: Ubiquitin-conjugating enzyme E2 ... 52 3e-06 UniRef50_Q9C6Q4 Cluster: Ubiquitin carrier protein; n=10; Eukary... 52 3e-06 UniRef50_Q9VYN3 Cluster: Ubiquitin carrier protein; n=2; Sophoph... 52 3e-06 UniRef50_Q8IJ70 Cluster: Ubiquitin carrier protein; n=9; Aconoid... 52 3e-06 UniRef50_P16577 Cluster: Ubiquitin-conjugating enzyme E2-23 kDa;... 52 3e-06 UniRef50_Q7SXH5 Cluster: Ubiquitin carrier protein; n=9; Eukaryo... 51 4e-06 UniRef50_Q6E683 Cluster: Ubiquitin carrier protein; n=1; Antonos... 51 4e-06 UniRef50_A0C3F7 Cluster: Ubiquitin carrier protein; n=2; Paramec... 51 6e-06 UniRef50_Q5KIQ6 Cluster: Ubiquitin carrier protein; n=1; Filobas... 51 6e-06 UniRef50_P52492 Cluster: Ubiquitin-conjugating enzyme E2-18 kDa;... 51 6e-06 UniRef50_UPI00015B62F0 Cluster: PREDICTED: hypothetical protein;... 50 8e-06 UniRef50_Q7QVX4 Cluster: Ubiquitin carrier protein; n=1; Giardia... 50 8e-06 UniRef50_Q4Q3Q8 Cluster: Ubiquitin carrier protein; n=4; Leishma... 50 8e-06 UniRef50_A2GNR9 Cluster: Ubiquitin conjugating protein, putative... 50 8e-06 UniRef50_A2GLA4 Cluster: Ubiquitin-conjugating enzyme family pro... 50 8e-06 UniRef50_A6RMU5 Cluster: Ubiquitin carrier protein; n=6; Ascomyc... 50 8e-06 UniRef50_Q95017 Cluster: SUMO-conjugating enzyme UBC9; n=7; Euka... 50 8e-06 UniRef50_UPI000155BB09 Cluster: PREDICTED: hypothetical protein;... 50 1e-05 UniRef50_Q9UTN8 Cluster: Ubiquitin conjugating enzyme Ubc14; n=1... 50 1e-05 UniRef50_Q4PH88 Cluster: Ubiquitin carrier protein; n=3; Dikarya... 50 1e-05 UniRef50_P35128 Cluster: Ubiquitin-conjugating enzyme E2-17 kDa;... 50 1e-05 UniRef50_Q24HQ3 Cluster: Ubiquitin carrier protein; n=1; Tetrahy... 50 1e-05 UniRef50_A2FAR7 Cluster: Ubiquitin carrier protein; n=1; Trichom... 50 1e-05 UniRef50_UPI00006CB320 Cluster: Ubiquitin-conjugating enzyme fam... 49 2e-05 UniRef50_P21734 Cluster: Ubiquitin-conjugating enzyme E2-24 kDa;... 49 2e-05 UniRef50_Q57XM0 Cluster: Ubiquitin carrier protein; n=1; Trypano... 49 2e-05 UniRef50_A7RL90 Cluster: Predicted protein; n=2; Nematostella ve... 49 2e-05 UniRef50_A5E394 Cluster: Putative uncharacterized protein; n=1; ... 49 2e-05 UniRef50_Q16763 Cluster: Ubiquitin-conjugating enzyme E2 S; n=33... 49 2e-05 UniRef50_Q9FI61 Cluster: Ubiquitin carrier protein; n=3; Viridip... 48 3e-05 UniRef50_Q6LFK4 Cluster: Ubiquitin-conjugating enzyme E2, putati... 48 3e-05 UniRef50_Q5DI37 Cluster: Ubiquitin carrier protein; n=2; Schisto... 48 3e-05 UniRef50_A6SKB5 Cluster: Putative uncharacterized protein; n=2; ... 48 3e-05 UniRef50_A3C6U5 Cluster: Ubiquitin carrier protein; n=2; Oryza s... 48 4e-05 UniRef50_Q586X5 Cluster: Ubiquitin carrier protein; n=3; Trypano... 48 4e-05 UniRef50_Q4PA94 Cluster: Ubiquitin carrier protein; n=11; Eukary... 48 4e-05 UniRef50_Q4DVH2 Cluster: Ubiquitin carrier protein; n=2; Trypano... 48 5e-05 UniRef50_A7STQ7 Cluster: Predicted protein; n=2; Nematostella ve... 48 5e-05 UniRef50_Q4WU34 Cluster: Ubiquitin carrier protein; n=16; Pezizo... 48 5e-05 UniRef50_Q9FF66 Cluster: Ubiquitin carrier protein; n=8; Viridip... 47 7e-05 UniRef50_Q4CQP3 Cluster: Ubiquitin carrier protein; n=4; Trypano... 47 7e-05 UniRef50_A2F4E2 Cluster: Ubiquitin carrier protein; n=1; Trichom... 47 7e-05 UniRef50_A2F262 Cluster: Ubiquitin carrier protein; n=3; Eukaryo... 47 7e-05 UniRef50_Q1DRT9 Cluster: Ubiquitin carrier protein; n=1; Coccidi... 47 7e-05 UniRef50_A5DB66 Cluster: Ubiquitin carrier protein; n=1; Pichia ... 47 7e-05 UniRef50_Q9NPD8 Cluster: Ubiquitin-conjugating enzyme E2 T; n=16... 47 7e-05 UniRef50_P42750 Cluster: Ubiquitin-conjugating enzyme E2-21 kDa ... 47 7e-05 UniRef50_Q96LR5 Cluster: Ubiquitin-conjugating enzyme E2 E2; n=1... 47 7e-05 UniRef50_P28263 Cluster: Ubiquitin-conjugating enzyme E2-24 kDa;... 47 1e-04 UniRef50_Q8SR07 Cluster: UBIQUITIN CONJUGATING ENZYME E2-20K; n=... 46 1e-04 UniRef50_A7TMT8 Cluster: Putative uncharacterized protein; n=1; ... 46 1e-04 UniRef50_P61086 Cluster: Ubiquitin-conjugating enzyme E2-25 kDa ... 46 1e-04 UniRef50_UPI00015B555D Cluster: PREDICTED: similar to ubiquitin-... 46 2e-04 UniRef50_UPI00006CC0C2 Cluster: Ubiquitin-conjugating enzyme fam... 46 2e-04 UniRef50_UPI00006CB812 Cluster: Ubiquitin-conjugating enzyme fam... 46 2e-04 UniRef50_A2AX46 Cluster: Ubiquitin carrier protein; n=2; Eukaryo... 46 2e-04 UniRef50_Q4QIK2 Cluster: Ubiquitin carrier protein; n=6; Trypano... 46 2e-04 UniRef50_Q4QBT6 Cluster: Ubiquitin-conjugating enzyme-like prote... 46 2e-04 UniRef50_Q4N5Y1 Cluster: Ubiquitin carrier protein; n=3; Piropla... 46 2e-04 UniRef50_Q5BE71 Cluster: Ubiquitin carrier protein; n=2; Trichoc... 46 2e-04 UniRef50_Q5A339 Cluster: Ubiquitin carrier protein; n=2; Eukaryo... 46 2e-04 UniRef50_Q9LV54 Cluster: Ubiquitin carrier protein; n=2; Arabido... 46 2e-04 UniRef50_P68036 Cluster: Ubiquitin-conjugating enzyme E2 L3; n=6... 46 2e-04 UniRef50_UPI0000499A56 Cluster: ubiquitin-conjugating enzyme; n=... 45 3e-04 UniRef50_Q7QWW0 Cluster: Ubiquitin carrier protein; n=1; Giardia... 45 3e-04 UniRef50_Q54VW9 Cluster: Ubiquitin carrier protein; n=1; Dictyos... 45 3e-04 UniRef50_A2D9T6 Cluster: Ubiquitin carrier protein; n=1; Trichom... 45 3e-04 UniRef50_Q0JAS6 Cluster: Os04g0580400 protein; n=1; Oryza sativa... 45 4e-04 UniRef50_A2AX45 Cluster: Ubiquitin carrier protein; n=1; Guillar... 45 4e-04 UniRef50_Q54J12 Cluster: Ubiquitin carrier protein; n=1; Dictyos... 45 4e-04 UniRef50_A2EFK5 Cluster: Ubiquitin carrier protein; n=1; Trichom... 45 4e-04 UniRef50_Q6MYZ2 Cluster: Ubiquitin carrier protein; n=7; Trichoc... 45 4e-04 UniRef50_Q1E8C5 Cluster: Ubiquitin carrier protein; n=9; Pezizom... 45 4e-04 UniRef50_Q43780 Cluster: Ubiquitin carrier protein; n=15; Eukary... 44 5e-04 UniRef50_Q5CQL8 Cluster: Ubiquitin carrier protein; n=2; Cryptos... 44 5e-04 UniRef50_Q6BRS6 Cluster: Similarities with CA4803|CaPEX4 Candida... 44 5e-04 UniRef50_Q4PBN3 Cluster: Ubiquitin carrier protein; n=1; Ustilag... 44 5e-04 UniRef50_Q9LQI1 Cluster: F15O4.3; n=1; Arabidopsis thaliana|Rep:... 44 7e-04 UniRef50_Q9VGD6 Cluster: CG14739-PA; n=2; Sophophora|Rep: CG1473... 44 7e-04 UniRef50_Q4QAG0 Cluster: Ubiquitin-conjugating enzyme E2, putati... 44 7e-04 UniRef50_P52484 Cluster: Probable ubiquitin-conjugating enzyme E... 44 7e-04 UniRef50_Q9LJD7 Cluster: Constitutive photomorphogenesis protein... 44 7e-04 UniRef50_UPI00001628C0 Cluster: UBC7 (ubiquitin-conjugating enzy... 44 9e-04 UniRef50_A2WYK3 Cluster: Ubiquitin carrier protein; n=2; Oryza s... 44 9e-04 UniRef50_Q4Q5L3 Cluster: Ubiquitin carrier protein; n=6; Trypano... 44 9e-04 UniRef50_A7RLE1 Cluster: Predicted protein; n=1; Nematostella ve... 44 9e-04 UniRef50_A3FPP4 Cluster: Ubiquitin carrier protein; n=1; Cryptos... 44 9e-04 UniRef50_A2EY78 Cluster: Ubiquitin carrier protein; n=1; Trichom... 44 9e-04 UniRef50_A2DSA6 Cluster: Ubiquitin carrier protein; n=1; Trichom... 44 9e-04 UniRef50_Q8LGF7 Cluster: Ubiquitin carrier protein; n=7; Eukaryo... 43 0.001 UniRef50_Q54F00 Cluster: Ubiquitin carrier protein; n=3; Eukaryo... 43 0.001 UniRef50_UPI0000D56950 Cluster: PREDICTED: similar to Ubiquitin-... 43 0.002 UniRef50_UPI00005A4DED Cluster: PREDICTED: similar to ubiquitin-... 43 0.002 UniRef50_A0C0C6 Cluster: Chromosome undetermined scaffold_14, wh... 43 0.002 UniRef50_A4RG25 Cluster: Putative uncharacterized protein; n=4; ... 43 0.002 UniRef50_O14933 Cluster: Ubiquitin/ISG15-conjugating enzyme E2 L... 43 0.002 UniRef50_Q0JLE6 Cluster: Ubiquitin carrier protein; n=4; Magnoli... 42 0.002 UniRef50_A2EHU5 Cluster: Ubiquitin carrier protein; n=1; Trichom... 42 0.002 UniRef50_A0BKX8 Cluster: Chromosome undetermined scaffold_113, w... 42 0.002 UniRef50_Q8SRC0 Cluster: Ubiquitin carrier protein; n=1; Encepha... 42 0.002 UniRef50_Q8SSK8 Cluster: UBIQUITIN CONJUGATING ENZYME E2; n=1; E... 42 0.004 UniRef50_Q969M7 Cluster: NEDD8-conjugating enzyme UBE2F; n=34; E... 42 0.004 UniRef50_Q9QZU9 Cluster: Ubiquitin/ISG15-conjugating enzyme E2 L... 42 0.004 UniRef50_Q7R2Z1 Cluster: Ubiquitin carrier protein; n=1; Giardia... 41 0.005 UniRef50_Q6C713 Cluster: Similarities with DEHA0D15444g Debaryom... 41 0.005 UniRef50_Q1EB54 Cluster: Ubiquitin-conjugating enzyme; n=7; Pezi... 41 0.005 UniRef50_UPI0001554972 Cluster: PREDICTED: similar to hCG2039566... 41 0.006 UniRef50_Q0R0E6 Cluster: Ubiquitin carrier protein; n=1; Symbiod... 41 0.006 UniRef50_Q54I43 Cluster: Ubiquitin carrier protein; n=3; Eukaryo... 41 0.006 UniRef50_Q8SS54 Cluster: Ubiquitin carrier protein; n=1; Encepha... 41 0.006 UniRef50_A2FS62 Cluster: Ubiquitin carrier protein; n=1; Trichom... 40 0.008 UniRef50_A0CD76 Cluster: Ubiquitin carrier protein; n=4; Paramec... 40 0.008 UniRef50_A0BIB5 Cluster: Chromosome undetermined scaffold_11, wh... 40 0.008 UniRef50_Q4PGW5 Cluster: Ubiquitin carrier protein; n=2; Basidio... 40 0.008 UniRef50_A4GFM0 Cluster: Peroxin 4; n=1; Penicillium chrysogenum... 40 0.008 UniRef50_Q9AW53 Cluster: Ubiquitin carrier protein; n=1; Guillar... 40 0.011 UniRef50_A2G420 Cluster: Ubiquitin carrier protein; n=1; Trichom... 40 0.011 UniRef50_A2EP72 Cluster: Ubiquitin carrier protein; n=1; Trichom... 40 0.011 UniRef50_Q0TZE7 Cluster: Ubiquitin carrier protein; n=1; Phaeosp... 40 0.011 UniRef50_UPI00006CC8BE Cluster: Ubiquitin-conjugating enzyme fam... 40 0.015 UniRef50_Q54P16 Cluster: Ubiquitin conjugating enzyme; n=2; Dict... 40 0.015 UniRef50_Q8IH42 Cluster: Ubiquitin carrier protein; n=15; Fungi/... 39 0.019 UniRef50_Q22BX5 Cluster: Ubiquitin carrier protein; n=5; Tetrahy... 39 0.019 UniRef50_Q55U75 Cluster: Ubiquitin carrier protein; n=2; Filobas... 39 0.019 UniRef50_UPI0000498C2E Cluster: ubiquitin-conjugating enzyme; n=... 39 0.025 UniRef50_Q6CPL4 Cluster: Kluyveromyces lactis strain NRRL Y-1140... 39 0.025 UniRef50_A7TL65 Cluster: Putative uncharacterized protein; n=1; ... 39 0.025 UniRef50_P49428 Cluster: Ubiquitin-conjugating enzyme E2-24 kDa;... 39 0.025 UniRef50_P14682 Cluster: Ubiquitin-conjugating enzyme E2-34 kDa;... 39 0.025 UniRef50_Q9XVK5 Cluster: NEDD8-conjugating enzyme ubc-12; n=3; C... 39 0.025 UniRef50_Q98S78 Cluster: Ubiquitin-conjugating enzyme E2-17 KD s... 38 0.034 UniRef50_P62256 Cluster: Ubiquitin-conjugating enzyme E2 H; n=51... 37 0.078 UniRef50_P62253 Cluster: Ubiquitin-conjugating enzyme E2 G1; n=6... 37 0.078 UniRef50_Q753J8 Cluster: AFR314Wp; n=1; Eremothecium gossypii|Re... 37 0.10 UniRef50_Q4U8F2 Cluster: Ubiquitin carrier protein; n=2; Piropla... 36 0.14 UniRef50_A2DRC1 Cluster: Ubiquitin carrier protein; n=1; Trichom... 36 0.18 UniRef50_A0DYM1 Cluster: Chromosome undetermined scaffold_7, who... 36 0.18 UniRef50_A3AAT7 Cluster: Putative uncharacterized protein; n=4; ... 36 0.24 UniRef50_Q2H4J3 Cluster: Putative uncharacterized protein; n=2; ... 36 0.24 UniRef50_A7TP75 Cluster: Putative uncharacterized protein; n=1; ... 36 0.24 UniRef50_A3LYJ5 Cluster: Predicted protein; n=3; Saccharomycetal... 36 0.24 UniRef50_A0BWT5 Cluster: Chromosome undetermined scaffold_133, w... 35 0.31 UniRef50_Q7SGR9 Cluster: Ubiquitin carrier protein; n=11; Pezizo... 35 0.31 UniRef50_P42743 Cluster: Ubiquitin-conjugating enzyme E2-18 kDa;... 35 0.31 UniRef50_Q8ILW5 Cluster: Ubiquitin conjugating enzyme, putative;... 35 0.41 UniRef50_Q7QQ94 Cluster: Ubiquitin carrier protein; n=1; Giardia... 35 0.41 UniRef50_Q28XJ5 Cluster: GA20189-PA; n=1; Drosophila pseudoobscu... 35 0.41 UniRef50_Q20617 Cluster: Putative uncharacterized protein ubc-24... 35 0.41 UniRef50_Q4P8X0 Cluster: Putative uncharacterized protein; n=1; ... 35 0.41 UniRef50_Q96B02 Cluster: Probable ubiquitin-conjugating enzyme E... 35 0.41 UniRef50_P27949 Cluster: Ubiquitin-conjugating enzyme E2-21 kDa;... 35 0.41 UniRef50_UPI0000E487EE Cluster: PREDICTED: similar to ubiquitin ... 34 0.55 UniRef50_Q9N2W9 Cluster: Ubiquitin carrier protein; n=1; Caenorh... 34 0.55 UniRef50_Q6BZP7 Cluster: Similarity; n=1; Yarrowia lipolytica|Re... 34 0.55 UniRef50_A7Q2F7 Cluster: Chromosome chr1 scaffold_46, whole geno... 34 0.72 UniRef50_Q5VVX9 Cluster: Ubiquitin-conjugating enzyme E2 U; n=11... 34 0.72 UniRef50_UPI0000F2BBBB Cluster: PREDICTED: similar to ubiquitin-... 33 0.96 UniRef50_Q23GA4 Cluster: Ubiquitin-conjugating enzyme family pro... 33 0.96 UniRef50_A0BMS1 Cluster: Chromosome undetermined scaffold_117, w... 33 0.96 UniRef50_A0A5E9 Cluster: Ubiquitin-conjugating enzyme,; n=1; Tox... 33 0.96 UniRef50_A5DNI5 Cluster: Putative uncharacterized protein; n=1; ... 33 0.96 UniRef50_P29340 Cluster: Ubiquitin-conjugating enzyme E2-21 kDa;... 33 0.96 UniRef50_UPI00006064E0 Cluster: PREDICTED: similar to ubiquitin-... 33 1.3 UniRef50_A2QG50 Cluster: Ubiquitin carrier protein; n=1; Aspergi... 33 1.3 UniRef50_Q9P6I1 Cluster: Ubiquitin-conjugating enzyme E2 16; n=1... 33 1.3 UniRef50_Q5YES5 Cluster: Ubiquitin conjugating enzyme E2 2; n=1;... 33 1.7 UniRef50_Q23K87 Cluster: Putative uncharacterized protein; n=1; ... 33 1.7 UniRef50_Q0JI74 Cluster: Ubiquitin carrier protein; n=2; Oryza s... 32 2.2 UniRef50_Q54J27 Cluster: Ubiquitin carrier protein; n=6; Eukaryo... 32 2.2 UniRef50_UPI000150A88B Cluster: Ubiquitin-conjugating enzyme fam... 32 2.9 UniRef50_UPI000050708E Cluster: PREDICTED: similar to ubiquitin-... 32 2.9 UniRef50_A0CCE4 Cluster: Chromosome undetermined scaffold_167, w... 32 2.9 UniRef50_A6SB88 Cluster: Predicted protein; n=1; Botryotinia fuc... 32 2.9 UniRef50_UPI000066142F Cluster: Homolog of Brachydanio rerio "Ub... 31 3.9 UniRef50_Q0IF72 Cluster: Ubiquitin-conjugating enzyme morgue; n=... 31 3.9 UniRef50_Q5PPQ4 Cluster: CDNA sequence BC043301; n=6; Murinae|Re... 31 5.1 UniRef50_Q4Q5I6 Cluster: Ubiquitin carrier protein; n=5; Trypano... 31 5.1 UniRef50_O62471 Cluster: Putative uncharacterized protein qui-1;... 31 5.1 UniRef50_UPI00015B43E7 Cluster: PREDICTED: similar to ubiquitin-... 31 6.7 UniRef50_Q5UQ40 Cluster: Putative uncharacterized protein; n=1; ... 31 6.7 UniRef50_Q2SHS3 Cluster: Secreted trypsin-like serine protease; ... 31 6.7 UniRef50_Q4C9G5 Cluster: PemK-like protein; n=1; Crocosphaera wa... 31 6.7 UniRef50_A6V9G8 Cluster: Putative uncharacterized protein; n=1; ... 31 6.7 UniRef50_Q18288 Cluster: Ubiquitin conjugating enzyme protein 23... 31 6.7 UniRef50_A0C867 Cluster: Ubiquitin carrier protein; n=4; Oligohy... 31 6.7 UniRef50_P60604 Cluster: Ubiquitin-conjugating enzyme E2 G2; n=8... 31 6.7 UniRef50_Q01631 Cluster: Adenylate cyclase; n=7; Sordariomycetes... 31 6.7 UniRef50_UPI00015B5F18 Cluster: PREDICTED: similar to retinaldeh... 30 8.9 UniRef50_UPI0000498417 Cluster: ubiquitin-conjugating enzyme; n=... 30 8.9 UniRef50_A2ADC1 Cluster: Novel protein containing an Ubiquitin-c... 30 8.9 UniRef50_A5FF61 Cluster: Amino acid permease-associated region; ... 30 8.9 UniRef50_A5C5F0 Cluster: Putative uncharacterized protein; n=1; ... 30 8.9 UniRef50_A0BMK7 Cluster: Chromosome undetermined scaffold_116, w... 30 8.9 UniRef50_Q5KGB0 Cluster: Putative uncharacterized protein; n=1; ... 30 8.9 >UniRef50_P61081 Cluster: NEDD8-conjugating enzyme Ubc12; n=24; Eukaryota|Rep: NEDD8-conjugating enzyme Ubc12 - Homo sapiens (Human) Length = 183 Score = 159 bits (387), Expect = 9e-39 Identities = 69/79 (87%), Positives = 78/79 (98%) Frame = +3 Query: 15 DLEGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHV 194 DLEGNVCLNILREDWKPVLT+NSI+YGLQYLFLEPNPEDPLNKEAA+ LQ+NRRLFEQ+V Sbjct: 105 DLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNV 164 Query: 195 QRAMRGGYVGTSYFERCLK 251 QR+MRGGY+G++YFERCLK Sbjct: 165 QRSMRGGYIGSTYFERCLK 183 >UniRef50_Q4SUR6 Cluster: Ubiquitin carrier protein; n=1; Tetraodon nigroviridis|Rep: Ubiquitin carrier protein - Tetraodon nigroviridis (Green puffer) Length = 226 Score = 152 bits (368), Expect = 2e-36 Identities = 67/79 (84%), Positives = 75/79 (94%) Frame = +3 Query: 15 DLEGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHV 194 DLEGNVCLNILREDWKPVLT+NSI+YGLQYLFLEPNPEDPLNKEAA+ LQ+NRRLFEQ+V Sbjct: 148 DLEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNV 207 Query: 195 QRAMRGGYVGTSYFERCLK 251 R++RGGYVG+ FERCLK Sbjct: 208 HRSLRGGYVGSICFERCLK 226 >UniRef50_A5DY26 Cluster: Ubiquitin carrier protein; n=3; Saccharomycetaceae|Rep: Ubiquitin carrier protein - Lodderomyces elongisporus (Yeast) (Saccharomyces elongisporus) Length = 211 Score = 111 bits (267), Expect = 3e-24 Identities = 46/75 (61%), Positives = 62/75 (82%) Frame = +3 Query: 15 DLEGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHV 194 DL+GN+CLNILREDW PVL++NS++ GL +LFLEPNP DPLNKEAA+ L +++ FE++V Sbjct: 134 DLQGNICLNILREDWSPVLSLNSVLIGLNFLFLEPNPNDPLNKEAANMLVKDKKQFERNV 193 Query: 195 QRAMRGGYVGTSYFE 239 + MRGGYV Y++ Sbjct: 194 RNLMRGGYVDGEYYD 208 >UniRef50_A6RUK1 Cluster: Ubiquitin carrier protein; n=2; Sclerotiniaceae|Rep: Ubiquitin carrier protein - Botryotinia fuckeliana B05.10 Length = 185 Score = 110 bits (265), Expect = 5e-24 Identities = 50/79 (63%), Positives = 63/79 (79%) Frame = +3 Query: 15 DLEGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHV 194 D+EG +CLNILREDWKPVL + +IV GLQ+LFLEPN DPLNKEAA++L+SNR F+++V Sbjct: 106 DVEGKICLNILREDWKPVLNLQAIVIGLQFLFLEPNASDPLNKEAAEDLRSNREGFKRNV 165 Query: 195 QRAMRGGYVGTSYFERCLK 251 + AM GG V F+R LK Sbjct: 166 RSAMGGGSVKNDSFDRVLK 184 >UniRef50_Q6C9W0 Cluster: NEDD8-conjugating enzyme UBC12; n=41; Eukaryota|Rep: NEDD8-conjugating enzyme UBC12 - Yarrowia lipolytica (Candida lipolytica) Length = 179 Score = 107 bits (256), Expect = 6e-23 Identities = 46/75 (61%), Positives = 61/75 (81%) Frame = +3 Query: 15 DLEGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHV 194 DLEGNVCLNILREDWKPVL++N+++ GLQYLFLEPN DPLNK+AA ++ +NR F+++V Sbjct: 100 DLEGNVCLNILREDWKPVLSLNAVMIGLQYLFLEPNASDPLNKDAAHQMTANREEFKRNV 159 Query: 195 QRAMRGGYVGTSYFE 239 + +M GG V F+ Sbjct: 160 KHSMAGGSVAGERFD 174 >UniRef50_Q54TI6 Cluster: Ubiquitin carrier protein; n=1; Dictyostelium discoideum AX4|Rep: Ubiquitin carrier protein - Dictyostelium discoideum AX4 Length = 230 Score = 105 bits (251), Expect = 3e-22 Identities = 42/78 (53%), Positives = 61/78 (78%) Frame = +3 Query: 15 DLEGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHV 194 DLEG+VCLNILR+DW PVL + ++++GL LFLEPNP+DPLNK+AA + N++ FE +V Sbjct: 153 DLEGHVCLNILRQDWMPVLNIGTVIFGLMTLFLEPNPDDPLNKDAAQLMIDNKKTFEANV 212 Query: 195 QRAMRGGYVGTSYFERCL 248 ++++RGGY+ F + L Sbjct: 213 RQSLRGGYISNRQFPKLL 230 >UniRef50_Q5A7Q5 Cluster: Ubiquitin carrier protein; n=2; Ascomycota|Rep: Ubiquitin carrier protein - Candida albicans (Yeast) Length = 194 Score = 103 bits (246), Expect = 1e-21 Identities = 43/78 (55%), Positives = 60/78 (76%) Frame = +3 Query: 15 DLEGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHV 194 DL+GN+CLNILREDW PVL++ + GL +LFL+PN DPLNK+AA+ L NR+ FE +V Sbjct: 117 DLQGNICLNILREDWSPVLSLTGVFMGLNFLFLDPNATDPLNKDAANVLVKNRKQFEINV 176 Query: 195 QRAMRGGYVGTSYFERCL 248 +MRGGY+ + Y++R + Sbjct: 177 FNSMRGGYLDSVYYDRVI 194 >UniRef50_Q247Y5 Cluster: Ubiquitin carrier protein; n=1; Tetrahymena thermophila SB210|Rep: Ubiquitin carrier protein - Tetrahymena thermophila SB210 Length = 186 Score = 101 bits (243), Expect = 2e-21 Identities = 42/78 (53%), Positives = 61/78 (78%) Frame = +3 Query: 15 DLEGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHV 194 DL+GNVCLNILR DWKPVL + +I+ G+ +LF+EPNP DPLNK+AA ++ ++ + FE V Sbjct: 109 DLQGNVCLNILRADWKPVLNLYNIISGVLFLFIEPNPNDPLNKQAASQMINDIKAFEADV 168 Query: 195 QRAMRGGYVGTSYFERCL 248 ++++RGG VG YF + + Sbjct: 169 KKSLRGGQVGGEYFPKLI 186 >UniRef50_O74549 Cluster: NEDD8-conjugating enzyme ubc12; n=10; Dikarya|Rep: NEDD8-conjugating enzyme ubc12 - Schizosaccharomyces pombe (Fission yeast) Length = 177 Score = 99 bits (238), Expect = 1e-20 Identities = 45/78 (57%), Positives = 57/78 (73%) Frame = +3 Query: 15 DLEGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHV 194 D+EGNVCLNILR+DW PVL +NSI+ GLQ+LFL PN EDPLNKEAA +L + + F V Sbjct: 99 DIEGNVCLNILRQDWNPVLNLNSILVGLQFLFLSPNAEDPLNKEAAADLHKDPQGFASRV 158 Query: 195 QRAMRGGYVGTSYFERCL 248 + AM+GG V F+ + Sbjct: 159 RTAMKGGLVNGISFDNVM 176 >UniRef50_Q8R352 Cluster: Ube2m protein; n=1; Mus musculus|Rep: Ube2m protein - Mus musculus (Mouse) Length = 102 Score = 95.1 bits (226), Expect = 3e-19 Identities = 54/101 (53%), Positives = 66/101 (65%), Gaps = 29/101 (28%) Frame = +3 Query: 36 LNILREDWKPVLTVNSIVYGLQYLFLEP------------------------NPEDP--- 134 L+ REDWKPVLT+NSI+YGLQYLFL P++P Sbjct: 2 LSAHREDWKPVLTINSIIYGLQYLFLVSRVRHLKLRVCWPSASLLPVDFHLYRPQEPNPE 61 Query: 135 --LNKEAADELQSNRRLFEQHVQRAMRGGYVGTSYFERCLK 251 LNKEAA+ LQ+NRRLFEQ+VQR+MRGGY+G++YFERCLK Sbjct: 62 DPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK 102 >UniRef50_A7TRY4 Cluster: Putative uncharacterized protein; n=1; Vanderwaltozyma polyspora DSM 70294|Rep: Putative uncharacterized protein - Vanderwaltozyma polyspora DSM 70294 Length = 192 Score = 88.6 bits (210), Expect = 2e-17 Identities = 39/66 (59%), Positives = 51/66 (77%) Frame = +3 Query: 15 DLEGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHV 194 DL+G +CLNILREDW P L +NSI+ GL YLFLE N +DPLNKEAA+ L S+ +F ++V Sbjct: 115 DLDGKICLNILREDWSPALDLNSIIIGLLYLFLECNAKDPLNKEAANILHSDEDMFRKYV 174 Query: 195 QRAMRG 212 + +M G Sbjct: 175 RDSMAG 180 >UniRef50_P52491 Cluster: NEDD8-conjugating enzyme UBC12; n=3; Saccharomycetales|Rep: NEDD8-conjugating enzyme UBC12 - Saccharomyces cerevisiae (Baker's yeast) Length = 188 Score = 88.6 bits (210), Expect = 2e-17 Identities = 40/69 (57%), Positives = 49/69 (71%) Frame = +3 Query: 15 DLEGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHV 194 DL+GNVCLNILREDW P L + SI+ GL +LFLEPNP DPLNK+AA L + F + V Sbjct: 109 DLKGNVCLNILREDWSPALDLQSIITGLLFLFLEPNPNDPLNKDAAKLLCEGEKEFAEAV 168 Query: 195 QRAMRGGYV 221 + M GG + Sbjct: 169 RLTMSGGSI 177 >UniRef50_Q75AF2 Cluster: NEDD8-conjugating enzyme UBC12; n=2; Eremothecium gossypii|Rep: NEDD8-conjugating enzyme UBC12 - Ashbya gossypii (Yeast) (Eremothecium gossypii) Length = 184 Score = 88.6 bits (210), Expect = 2e-17 Identities = 37/75 (49%), Positives = 52/75 (69%) Frame = +3 Query: 15 DLEGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHV 194 D GN+CLN+LREDW PV+ + ++V GL +LFLEPN DPLN++AAD + + FE +V Sbjct: 106 DYSGNICLNVLREDWSPVMDLQTVVLGLLFLFLEPNGSDPLNRQAADTMLRDPYRFETNV 165 Query: 195 QRAMRGGYVGTSYFE 239 Q M GG++ F+ Sbjct: 166 QATMMGGHLDGQVFD 180 >UniRef50_A0EBF3 Cluster: Ubiquitin carrier protein; n=1; Paramecium tetraurelia|Rep: Ubiquitin carrier protein - Paramecium tetraurelia Length = 185 Score = 85.4 bits (202), Expect = 2e-16 Identities = 38/77 (49%), Positives = 55/77 (71%), Gaps = 1/77 (1%) Frame = +3 Query: 15 DLEGNVCLNILREDWKPVLTVNSIVYGLQYLFLE-PNPEDPLNKEAADELQSNRRLFEQH 191 DLEG VCLNILREDW+PV ++ +++GLQ LF + NP DPLNKEAA+ + +++ F Q Sbjct: 107 DLEGKVCLNILREDWRPVSSLKDVIFGLQMLFTQLTNPTDPLNKEAAELMLKDQQQFAQV 166 Query: 192 VQRAMRGGYVGTSYFER 242 V+ M+GG + +E+ Sbjct: 167 VKSTMKGGSYNSILYEK 183 >UniRef50_Q6CSW8 Cluster: NEDD8-conjugating enzyme UBC12; n=1; Kluyveromyces lactis|Rep: NEDD8-conjugating enzyme UBC12 - Kluyveromyces lactis (Yeast) (Candida sphaerica) Length = 184 Score = 83.8 bits (198), Expect = 7e-16 Identities = 35/78 (44%), Positives = 52/78 (66%) Frame = +3 Query: 15 DLEGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHV 194 D++GNVCLN+LREDW P L + SI+ G+ +LF EPN DPLNK+AA L + FE V Sbjct: 106 DIDGNVCLNLLREDWTPALDIQSIIIGILFLFHEPNGRDPLNKDAAKTLIEDPLRFENKV 165 Query: 195 QRAMRGGYVGTSYFERCL 248 ++RG + ++++ + Sbjct: 166 NHSLRGNNIDGVWYDKII 183 >UniRef50_UPI000049916F Cluster: ubiquitin-conjugating enzyme; n=1; Entamoeba histolytica HM-1:IMSS|Rep: ubiquitin-conjugating enzyme - Entamoeba histolytica HM-1:IMSS Length = 185 Score = 77.0 bits (181), Expect = 8e-14 Identities = 36/69 (52%), Positives = 49/69 (71%), Gaps = 2/69 (2%) Frame = +3 Query: 15 DLEGNVCLNILR--EDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQ 188 DLEG+VCL+ LR +DW PV T+N +V GL LFLEPNP+DPLN EA + ++ + F + Sbjct: 106 DLEGHVCLSTLRLDKDWSPVSTLNHVVCGLLSLFLEPNPDDPLNTEAGETMKRDINEFVR 165 Query: 189 HVQRAMRGG 215 V + M+GG Sbjct: 166 LVNKTMKGG 174 >UniRef50_A6RGW5 Cluster: Ubiquitin carrier protein; n=1; Ajellomyces capsulatus NAm1|Rep: Ubiquitin carrier protein - Ajellomyces capsulatus NAm1 Length = 198 Score = 75.8 bits (178), Expect = 2e-13 Identities = 37/85 (43%), Positives = 55/85 (64%), Gaps = 6/85 (7%) Frame = +3 Query: 15 DLEGNVCLNILREDWKPVLTVNSIVYGL------QYLFLEPNPEDPLNKEAADELQSNRR 176 D +GNVCLNILR+ W L V ++ +GL Q++F+ EDPL +E AD+L+ NR Sbjct: 113 DPQGNVCLNILRDGWTAALDVQAVAFGLLHAKTKQHIFIHTTYEDPLIQEVADDLRLNRE 172 Query: 177 LFEQHVQRAMRGGYVGTSYFERCLK 251 F ++V+ AM+GG V + ++R LK Sbjct: 173 GFRRNVRTAMQGGTVRNTQYDRVLK 197 >UniRef50_A2E5I6 Cluster: Ubiquitin carrier protein; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin carrier protein - Trichomonas vaginalis G3 Length = 162 Score = 72.5 bits (170), Expect = 2e-12 Identities = 32/63 (50%), Positives = 42/63 (66%) Frame = +3 Query: 18 LEGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHVQ 197 L G VCLNILRE + P + +++++ G+QYLFLEPNP DPLN EAA+E + F H Sbjct: 89 LYGPVCLNILREKYTPAIPLSNLILGIQYLFLEPNPNDPLNVEAAEEFTKDNIKFRVHAH 148 Query: 198 RAM 206 M Sbjct: 149 DYM 151 >UniRef50_A2EGV7 Cluster: Ubiquitin carrier protein; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin carrier protein - Trichomonas vaginalis G3 Length = 175 Score = 71.3 bits (167), Expect = 4e-12 Identities = 30/62 (48%), Positives = 46/62 (74%) Frame = +3 Query: 15 DLEGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHV 194 D EG+VCL+ILRE + P +++ ++ G+QYLF EP P DPLNKEAA ++ ++ LF+ +V Sbjct: 90 DEEGSVCLSILREAYNPTVSIPFLIAGIQYLFTEPEPNDPLNKEAAQQMINDFALFKTNV 149 Query: 195 QR 200 + Sbjct: 150 DK 151 >UniRef50_A3FQP7 Cluster: Ubiquitin carrier protein; n=2; Cryptosporidium|Rep: Ubiquitin carrier protein - Cryptosporidium parvum Iowa II Length = 190 Score = 63.7 bits (148), Expect = 8e-10 Identities = 27/57 (47%), Positives = 40/57 (70%) Frame = +3 Query: 15 DLEGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFE 185 D G+VC+NI+REDWKP LT++ ++ GL L +EP+ DP N+ A+ +SN LF+ Sbjct: 127 DKLGHVCINIIREDWKPTLTISIVICGLLNLLIEPSNSDPFNEFASILFESNLSLFK 183 >UniRef50_A2E403 Cluster: Ubiquitin carrier protein; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin carrier protein - Trichomonas vaginalis G3 Length = 155 Score = 63.3 bits (147), Expect = 1e-09 Identities = 26/64 (40%), Positives = 41/64 (64%) Frame = +3 Query: 15 DLEGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHV 194 D EGN+CLNI++ D+ P +T+ I+ G++ +F+ PNP PLN AA+ L + F + V Sbjct: 85 DEEGNICLNIIKGDYNPTITILQIIQGIELIFVTPNPYSPLNNAAAEMLIHDESGFREKV 144 Query: 195 QRAM 206 + M Sbjct: 145 EEYM 148 >UniRef50_A2DXW4 Cluster: Ubiquitin carrier protein; n=2; Trichomonas vaginalis|Rep: Ubiquitin carrier protein - Trichomonas vaginalis G3 Length = 164 Score = 62.5 bits (145), Expect = 2e-09 Identities = 28/60 (46%), Positives = 40/60 (66%) Frame = +3 Query: 15 DLEGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHV 194 D G VCL+ILR+++ L+++ V GLQYLF+EPNP PLN EAA ++ F++ V Sbjct: 95 DENGAVCLSILRDNYLATLSISQFVAGLQYLFIEPNPNSPLNTEAATMFKNEPAKFQETV 154 >UniRef50_A7ARW5 Cluster: Putative uncharacterized protein; n=1; Babesia bovis|Rep: Putative uncharacterized protein - Babesia bovis Length = 423 Score = 61.7 bits (143), Expect = 3e-09 Identities = 28/49 (57%), Positives = 35/49 (71%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSN 170 G VCLNI+REDW+PV TV + GL L +EP P +PL+ EAA+ L SN Sbjct: 362 GAVCLNIVREDWRPVYTVGTAALGLLNLLVEPQPIEPLDAEAAELLVSN 410 >UniRef50_A2F2A5 Cluster: Ubiquitin carrier protein; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin carrier protein - Trichomonas vaginalis G3 Length = 162 Score = 59.7 bits (138), Expect = 1e-08 Identities = 23/63 (36%), Positives = 41/63 (65%) Frame = +3 Query: 21 EGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHVQR 200 +G +CL++L+ W P +++I+ ++ LF +PNP P N EAA+ Q+NR + + VQ+ Sbjct: 87 DGKICLDMLQNKWTPAYDISAILNSIRSLFDDPNPASPANGEAAEAFQNNRPKYNEKVQQ 146 Query: 201 AMR 209 +R Sbjct: 147 CVR 149 >UniRef50_Q4RS31 Cluster: Ubiquitin carrier protein; n=1; Tetraodon nigroviridis|Rep: Ubiquitin carrier protein - Tetraodon nigroviridis (Green puffer) Length = 221 Score = 59.3 bits (137), Expect = 2e-08 Identities = 25/58 (43%), Positives = 37/58 (63%) Frame = +3 Query: 21 EGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHV 194 +G++CL+IL+ W P V+SI+ +Q L EPNP P N +AA Q N+R +E+ V Sbjct: 153 DGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYEKRV 210 >UniRef50_Q4Y3H7 Cluster: Ubiquitin carrier protein; n=1; Plasmodium chabaudi|Rep: Ubiquitin carrier protein - Plasmodium chabaudi Length = 118 Score = 59.3 bits (137), Expect = 2e-08 Identities = 23/56 (41%), Positives = 38/56 (67%) Frame = +3 Query: 15 DLEGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLF 182 D GNVCLN+L+ DW P++ + ++ GL L EP+ DP N +AA+ L+++++ F Sbjct: 51 DENGNVCLNVLKLDWNPIINLQMLILGLILLLNEPSTNDPFNADAANVLKNDKQKF 106 >UniRef50_Q4UI29 Cluster: Ubiquitin-conjugating enzyme E2 (RUB1 homologue), putative; n=2; Theileria|Rep: Ubiquitin-conjugating enzyme E2 (RUB1 homologue), putative - Theileria annulata Length = 249 Score = 59.3 bits (137), Expect = 2e-08 Identities = 26/50 (52%), Positives = 37/50 (74%) Frame = +3 Query: 21 EGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSN 170 +G VCLNILREDW P+ T+++ + GL L +EP E+PL+K AA+ LQ + Sbjct: 185 KGAVCLNILREDWLPIYTIDTAIIGLVNLLIEPQFENPLDKFAANLLQKD 234 >UniRef50_A6NGR2 Cluster: Uncharacterized protein UBE2A (Ubiquitin-conjugating enzyme E2A (RAD6 homolog), isoform CRA_a); n=6; Euteleostomi|Rep: Uncharacterized protein UBE2A (Ubiquitin-conjugating enzyme E2A (RAD6 homolog), isoform CRA_a) - Homo sapiens (Human) Length = 122 Score = 59.3 bits (137), Expect = 2e-08 Identities = 25/58 (43%), Positives = 37/58 (63%) Frame = +3 Query: 21 EGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHV 194 +G++CL+IL+ W P V+SI+ +Q L EPNP P N +AA Q N+R +E+ V Sbjct: 54 DGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYEKRV 111 >UniRef50_P63146 Cluster: Ubiquitin-conjugating enzyme E2 B; n=55; Eukaryota|Rep: Ubiquitin-conjugating enzyme E2 B - Homo sapiens (Human) Length = 152 Score = 59.3 bits (137), Expect = 2e-08 Identities = 25/58 (43%), Positives = 37/58 (63%) Frame = +3 Query: 21 EGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHV 194 +G++CL+IL+ W P V+SI+ +Q L EPNP P N +AA Q N+R +E+ V Sbjct: 84 DGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYEKRV 141 >UniRef50_A2EJF5 Cluster: Ubiquitin-conjugating enzyme family protein; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin-conjugating enzyme family protein - Trichomonas vaginalis G3 Length = 162 Score = 58.8 bits (136), Expect = 2e-08 Identities = 23/62 (37%), Positives = 38/62 (61%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHVQRA 203 G VCL+IL + WKP + + I+ G+Q L +EPNPE P ++ D NR L++ +++ Sbjct: 93 GKVCLSILTDGWKPSINLRQILVGIQKLLIEPNPESPAHQVNYDNYMMNRPLYDANIKEC 152 Query: 204 MR 209 + Sbjct: 153 AK 154 >UniRef50_Q7QVV7 Cluster: Ubiquitin carrier protein; n=1; Giardia lamblia ATCC 50803|Rep: Ubiquitin carrier protein - Giardia lamblia ATCC 50803 Length = 159 Score = 58.4 bits (135), Expect = 3e-08 Identities = 24/68 (35%), Positives = 45/68 (66%), Gaps = 1/68 (1%) Frame = +3 Query: 21 EGNVCLNIL-REDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHVQ 197 +G +CL+IL +++WKPV + +++ ++ L +PNP+DP N +AA E +R L+E V+ Sbjct: 82 DGKICLDILTKKEWKPVYDLGTVLTSIRSLLCDPNPKDPANCDAAYEYIYDRHLYEMKVR 141 Query: 198 RAMRGGYV 221 +R ++ Sbjct: 142 ECVRNSWL 149 >UniRef50_Q4DY64 Cluster: Ubiquitin-conjugating enzyme E2, putative; n=2; Trypanosoma|Rep: Ubiquitin-conjugating enzyme E2, putative - Trypanosoma cruzi Length = 199 Score = 58.0 bits (134), Expect = 4e-08 Identities = 27/67 (40%), Positives = 42/67 (62%), Gaps = 3/67 (4%) Frame = +3 Query: 30 VCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLN---KEAADELQSNRRLFEQHVQR 200 VCL+ E WKP +++ I+ ++ LF +PNP+DPL+ K+AA ++ N F +R Sbjct: 133 VCLSFQTE-WKPTMSLRDIIIMIELLFQDPNPDDPLHGTAKQAAQMMKDNPAKFRDKARR 191 Query: 201 AMRGGYV 221 MRGGY+ Sbjct: 192 WMRGGYI 198 >UniRef50_A2YZH4 Cluster: Ubiquitin carrier protein; n=3; Spermatophyta|Rep: Ubiquitin carrier protein - Oryza sativa subsp. indica (Rice) Length = 284 Score = 57.6 bits (133), Expect = 5e-08 Identities = 22/55 (40%), Positives = 36/55 (65%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQ 188 G++CL+IL+E W P LT++ ++ + L +PNP+DPL E A +S R +E+ Sbjct: 82 GSICLDILKEQWSPALTISKVLLSISSLLTDPNPDDPLVPEIAHVYKSQRPRYEE 136 >UniRef50_Q8WXB3 Cluster: Ubiquitin carrier protein; n=8; Bilateria|Rep: Ubiquitin carrier protein - Homo sapiens (Human) Length = 80 Score = 57.6 bits (133), Expect = 5e-08 Identities = 24/56 (42%), Positives = 36/56 (64%) Frame = +3 Query: 21 EGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQ 188 +G++CL+IL+ W P V+SI+ +Q L EPNP P N +AA Q N+R +E+ Sbjct: 25 DGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYEK 80 >UniRef50_P25153 Cluster: Ubiquitin-conjugating enzyme E2-17 kDa; n=93; Eukaryota|Rep: Ubiquitin-conjugating enzyme E2-17 kDa - Drosophila melanogaster (Fruit fly) Length = 151 Score = 57.6 bits (133), Expect = 5e-08 Identities = 23/67 (34%), Positives = 39/67 (58%) Frame = +3 Query: 21 EGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHVQR 200 +G +CL+IL+ W P V++I+ +Q L +PNP P N AA + NRR +E+ V+ Sbjct: 84 DGGICLDILQNRWSPTYDVSAILTSIQSLLSDPNPNSPANSTAAQLYKENRREYEKRVKA 143 Query: 201 AMRGGYV 221 + ++ Sbjct: 144 CVEQSFI 150 >UniRef50_Q4WNS9 Cluster: Ubiquitin carrier protein; n=4; Ascomycota|Rep: Ubiquitin carrier protein - Aspergillus fumigatus (Sartorya fumigata) Length = 190 Score = 57.2 bits (132), Expect = 7e-08 Identities = 25/64 (39%), Positives = 41/64 (64%), Gaps = 2/64 (3%) Frame = +3 Query: 24 GNVCLNILRED--WKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHVQ 197 G VCL+IL E+ WKP +T+ I+ G+Q L +PNPE P EA + + +R +E+ V+ Sbjct: 122 GTVCLSILNEEEAWKPAITIKQILLGIQDLLDDPNPESPAQAEAYNLFKKDRPAYERRVR 181 Query: 198 RAMR 209 + ++ Sbjct: 182 QVVK 185 >UniRef50_Q9C8X7 Cluster: Putative ubiquitin conjugating enzyme; 36006-34873; n=1; Arabidopsis thaliana|Rep: Putative ubiquitin conjugating enzyme; 36006-34873 - Arabidopsis thaliana (Mouse-ear cress) Length = 154 Score = 56.0 bits (129), Expect = 2e-07 Identities = 22/59 (37%), Positives = 36/59 (61%) Frame = +3 Query: 21 EGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHVQ 197 EG++C+NIL++ W P L V ++ + L +PNP+DPL E ++NR F+Q + Sbjct: 87 EGSICMNILKDKWTPALMVEKVLLSILLLLEKPNPDDPLVPEIGQLFKNNRFQFDQRAR 145 >UniRef50_Q8I4X8 Cluster: Ubiquitin carrier protein; n=2; Plasmodium|Rep: Ubiquitin carrier protein - Plasmodium falciparum (isolate 3D7) Length = 157 Score = 56.0 bits (129), Expect = 2e-07 Identities = 22/58 (37%), Positives = 38/58 (65%) Frame = +3 Query: 15 DLEGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQ 188 D GNVCLN+L+ +W P++ + ++ GL L EP+ +DP NK AA+ +++ F++ Sbjct: 86 DESGNVCLNVLKLEWNPIINLQMLILGLLLLLDEPSTDDPFNKIAAEVFKNDIYKFQE 143 >UniRef50_A6NLF6 Cluster: Ubiquitin carrier protein; n=4; Eutheria|Rep: Ubiquitin carrier protein - Homo sapiens (Human) Length = 146 Score = 56.0 bits (129), Expect = 2e-07 Identities = 21/58 (36%), Positives = 37/58 (63%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHVQ 197 G++CL+ILR W P LTV+ ++ + L +PNP+DPL + A +S++ + +H + Sbjct: 81 GSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAR 138 >UniRef50_Q8SQR1 Cluster: Ubiquitin carrier protein; n=1; Encephalitozoon cuniculi|Rep: Ubiquitin carrier protein - Encephalitozoon cuniculi Length = 175 Score = 56.0 bits (129), Expect = 2e-07 Identities = 23/62 (37%), Positives = 38/62 (61%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHVQRA 203 G +C++IL ++W P LT+NS++ L L +PN +DPL E AD ++N+ + Q + Sbjct: 107 GMICIDILGKEWSPALTLNSVLLSLLTLLDDPNADDPLRPEVADIYKTNKEEYRLRCQES 166 Query: 204 MR 209 R Sbjct: 167 AR 168 >UniRef50_A2YII6 Cluster: Ubiquitin carrier protein; n=5; Eukaryota|Rep: Ubiquitin carrier protein - Oryza sativa subsp. indica (Rice) Length = 176 Score = 55.6 bits (128), Expect = 2e-07 Identities = 22/59 (37%), Positives = 36/59 (61%) Frame = +3 Query: 21 EGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHVQ 197 +G++CL+IL+ W P+ V +I+ +Q L +PNP P N EAA N+R + + V+ Sbjct: 108 DGSICLDILQNQWSPIYDVAAILTSIQSLLCDPNPNSPANSEAARLFSENKREYNRKVR 166 >UniRef50_Q9I7T6 Cluster: Ubiquitin carrier protein; n=5; Eukaryota|Rep: Ubiquitin carrier protein - Drosophila melanogaster (Fruit fly) Length = 354 Score = 55.6 bits (128), Expect = 2e-07 Identities = 21/60 (35%), Positives = 35/60 (58%) Frame = +3 Query: 18 LEGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHVQ 197 L G +CL+IL W P L+V+ ++ + L +PNP DP+ AD + NR L +++ + Sbjct: 287 LSGRICLDILGSKWSPALSVSKVLISIMSLLADPNPHDPMEVSVADVFKGNRALHDKNAR 346 >UniRef50_A0CH05 Cluster: Chromosome undetermined scaffold_18, whole genome shotgun sequence; n=3; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_18, whole genome shotgun sequence - Paramecium tetraurelia Length = 562 Score = 55.6 bits (128), Expect = 2e-07 Identities = 21/57 (36%), Positives = 38/57 (66%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHV 194 G VCL++L++ W P L+V S++ ++ L ++PNP+D L+ A E + + L+ Q+V Sbjct: 461 GAVCLDVLKDQWSPALSVFSVLLSIRSLLIDPNPDDALDSNVAAEYKHEKALYTQNV 517 >UniRef50_A6NP33 Cluster: Uncharacterized protein UBE2C; n=14; Theria|Rep: Uncharacterized protein UBE2C - Homo sapiens (Human) Length = 150 Score = 55.6 bits (128), Expect = 2e-07 Identities = 26/61 (42%), Positives = 39/61 (63%) Frame = +3 Query: 15 DLEGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHV 194 D +GN+CL+IL+E W + V +I+ +Q L EPN + PLN AA EL N F++++ Sbjct: 79 DTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAA-ELWKNPTAFKKYL 137 Query: 195 Q 197 Q Sbjct: 138 Q 138 >UniRef50_O00762 Cluster: Ubiquitin-conjugating enzyme E2 C; n=26; Eukaryota|Rep: Ubiquitin-conjugating enzyme E2 C - Homo sapiens (Human) Length = 179 Score = 55.6 bits (128), Expect = 2e-07 Identities = 26/61 (42%), Positives = 39/61 (63%) Frame = +3 Query: 15 DLEGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHV 194 D +GN+CL+IL+E W + V +I+ +Q L EPN + PLN AA EL N F++++ Sbjct: 108 DTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAA-ELWKNPTAFKKYL 166 Query: 195 Q 197 Q Sbjct: 167 Q 167 >UniRef50_P56616 Cluster: Ubiquitin-conjugating enzyme E2 C; n=20; Eukaryota|Rep: Ubiquitin-conjugating enzyme E2 C - Xenopus laevis (African clawed frog) Length = 179 Score = 55.2 bits (127), Expect = 3e-07 Identities = 26/60 (43%), Positives = 38/60 (63%) Frame = +3 Query: 15 DLEGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHV 194 D GN+CL+IL++ W + V +I+ LQ L EPN E PLN AA EL N+ +++H+ Sbjct: 108 DSHGNICLDILKDKWSALYDVRTILLSLQSLLGEPNNESPLNPYAA-ELWQNQTAYKKHL 166 >UniRef50_A0E1Q4 Cluster: Ubiquitin carrier protein; n=6; Eukaryota|Rep: Ubiquitin carrier protein - Paramecium tetraurelia Length = 720 Score = 54.8 bits (126), Expect = 4e-07 Identities = 25/68 (36%), Positives = 41/68 (60%), Gaps = 4/68 (5%) Frame = +3 Query: 21 EGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNR----RLFEQ 188 +G +CL+IL+E W P+L V +I+ ++ L +PNP P N EAA S+R R ++ Sbjct: 648 DGRICLDILKEQWTPILDVWAILTSIRSLLCDPNPNSPANPEAAKLYMSDRAEYYRRVKE 707 Query: 189 HVQRAMRG 212 V++ + G Sbjct: 708 QVEKTLNG 715 >UniRef50_P35132 Cluster: SUMO-conjugating enzyme UBC9; n=75; Eukaryota|Rep: SUMO-conjugating enzyme UBC9 - Arabidopsis thaliana (Mouse-ear cress) Length = 148 Score = 54.4 bits (125), Expect = 5e-07 Identities = 20/54 (37%), Positives = 36/54 (66%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFE 185 G++CL+IL+E W P LT++ ++ + L +PNP+DPL E A ++++ +E Sbjct: 82 GSICLDILKEQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDKNKYE 135 >UniRef50_Q7QT23 Cluster: Ubiquitin carrier protein; n=1; Giardia lamblia ATCC 50803|Rep: Ubiquitin carrier protein - Giardia lamblia ATCC 50803 Length = 196 Score = 53.6 bits (123), Expect = 8e-07 Identities = 23/65 (35%), Positives = 35/65 (53%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHVQRA 203 GN+CL++L W P L V++I+ +Q L +PNP P N EAA ++R + V Sbjct: 90 GNICLDLLSTKWTPALGVSAILLSIQSLLTDPNPMSPANNEAAALFVNDRHTYNLRVSMC 149 Query: 204 MRGGY 218 R + Sbjct: 150 TRNSW 154 >UniRef50_A0E347 Cluster: Ubiquitin carrier protein; n=4; Eukaryota|Rep: Ubiquitin carrier protein - Paramecium tetraurelia Length = 197 Score = 53.6 bits (123), Expect = 8e-07 Identities = 20/53 (37%), Positives = 35/53 (66%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLF 182 G +CL+IL++ W P L++ + + LQ LF +P P+ P + A++ +SN+ LF Sbjct: 90 GAICLDILKDQWSPALSIRTALLSLQALFCDPQPDSPQDAVVANQYKSNKDLF 142 >UniRef50_Q7RY50 Cluster: Putative uncharacterized protein NCU04513.1; n=4; Sordariomycetes|Rep: Putative uncharacterized protein NCU04513.1 - Neurospora crassa Length = 204 Score = 53.6 bits (123), Expect = 8e-07 Identities = 23/64 (35%), Positives = 41/64 (64%), Gaps = 1/64 (1%) Frame = +3 Query: 9 TRDLEGNVCLNILR-EDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFE 185 T D GN+CL +L+ E+WKP + S++ ++ + +EP P+D L + ADE + +R FE Sbjct: 81 TNDSLGNICLGLLKSENWKPASKIISVLEAVRNILVEPMPDDALEQRIADEYRRDRPEFE 140 Query: 186 QHVQ 197 ++ + Sbjct: 141 KNAR 144 >UniRef50_P61088 Cluster: Ubiquitin-conjugating enzyme E2 N; n=123; Eukaryota|Rep: Ubiquitin-conjugating enzyme E2 N - Homo sapiens (Human) Length = 152 Score = 53.2 bits (122), Expect = 1e-06 Identities = 19/52 (36%), Positives = 34/52 (65%) Frame = +3 Query: 15 DLEGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSN 170 D G +CL+IL++ W P L + +++ +Q L PNP+DPL + A++ ++N Sbjct: 81 DKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTN 132 >UniRef50_P63279 Cluster: SUMO-conjugating enzyme UBC9; n=74; Eukaryota|Rep: SUMO-conjugating enzyme UBC9 - Homo sapiens (Human) Length = 158 Score = 53.2 bits (122), Expect = 1e-06 Identities = 26/60 (43%), Positives = 36/60 (60%), Gaps = 2/60 (3%) Frame = +3 Query: 24 GNVCLNILRED--WKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHVQ 197 G VCL+IL ED W+P +T+ I+ G+Q L EPN +DP EA NR +E+ V+ Sbjct: 90 GTVCLSILEEDKDWRPAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQNRVEYEKRVR 149 >UniRef50_UPI0000F2B380 Cluster: PREDICTED: similar to Chain B, Crystal Structure Of Human Ubiquitin-Conjugating Enzyme Ubch5b; n=2; Amniota|Rep: PREDICTED: similar to Chain B, Crystal Structure Of Human Ubiquitin-Conjugating Enzyme Ubch5b - Monodelphis domestica Length = 270 Score = 52.4 bits (120), Expect = 2e-06 Identities = 20/55 (36%), Positives = 35/55 (63%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQ 188 G++CL+ILR W P LT++ ++ + L +PNP+DPL E A +++R + + Sbjct: 205 GSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNR 259 >UniRef50_Q54IK3 Cluster: Ubiquitin carrier protein; n=1; Dictyostelium discoideum AX4|Rep: Ubiquitin carrier protein - Dictyostelium discoideum AX4 Length = 585 Score = 52.4 bits (120), Expect = 2e-06 Identities = 17/40 (42%), Positives = 29/40 (72%) Frame = +3 Query: 21 EGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLN 140 +GN+CL+IL++ W P LT++ ++ + L + PNP DPL+ Sbjct: 506 DGNICLDILKDSWSPALTISKVMLSISQLLVTPNPHDPLD 545 >UniRef50_Q4YK13 Cluster: Ubiquitin carrier protein; n=2; Alveolata|Rep: Ubiquitin carrier protein - Plasmodium berghei Length = 149 Score = 52.4 bits (120), Expect = 2e-06 Identities = 20/58 (34%), Positives = 35/58 (60%) Frame = +3 Query: 21 EGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHV 194 +GN+CL+IL+ W P+ + S++ +Q L +PN P N EAA +++ L+ + V Sbjct: 73 DGNICLDILQNQWSPIYDITSLLTSIQSLLNDPNTASPANPEAAKIFMTDKLLYNKRV 130 >UniRef50_P62837 Cluster: Ubiquitin-conjugating enzyme E2 D2 (EC 6.3.2.19) (Ubiquitin-protein ligase D2) (Ubiquitin carrier protein D2) (Ubiquitin-conjugating enzyme E2-17 kDa 2) (E2(17)KB 2); n=169; Eukaryota|Rep: Ubiquitin-conjugating enzyme E2 D2 (EC 6.3.2.19) (Ubiquitin-protein ligase D2) (Ubiquitin carrier protein D2) (Ubiquitin-conjugating enzyme E2-17 kDa 2) (E2(17)KB 2) - Homo sapiens (Human) Length = 147 Score = 52.4 bits (120), Expect = 2e-06 Identities = 20/55 (36%), Positives = 35/55 (63%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQ 188 G++CL+ILR W P LT++ ++ + L +PNP+DPL E A +++R + + Sbjct: 82 GSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTDREKYNR 136 >UniRef50_Q7KNM2 Cluster: Ubiquitin carrier protein; n=39; Eukaryota|Rep: Ubiquitin carrier protein - Drosophila melanogaster (Fruit fly) Length = 159 Score = 52.0 bits (119), Expect = 3e-06 Identities = 26/64 (40%), Positives = 37/64 (57%), Gaps = 2/64 (3%) Frame = +3 Query: 24 GNVCLNILRE--DWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHVQ 197 G VCL++L E DW+P +T+ I+ G+Q L EPN +DP EA NR +E+ V+ Sbjct: 90 GTVCLSLLDEEKDWRPAITIKQILLGIQDLLNEPNIKDPAQAEAYTIYCQNRLEYEKRVR 149 Query: 198 RAMR 209 R Sbjct: 150 AQAR 153 >UniRef50_Q0UIW0 Cluster: Putative uncharacterized protein; n=1; Phaeosphaeria nodorum|Rep: Putative uncharacterized protein - Phaeosphaeria nodorum (Septoria nodorum) Length = 159 Score = 52.0 bits (119), Expect = 3e-06 Identities = 24/64 (37%), Positives = 41/64 (64%), Gaps = 1/64 (1%) Frame = +3 Query: 9 TRDLEGNVCLNILR-EDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFE 185 T D +G++CL +LR E WKP V +++ +Q L +EPN +D + A+E + NR+ FE Sbjct: 88 TNDDKGSMCLGLLRPESWKPPNKVVAVLRLIQTLLIEPNVDDAIEPSIANEYRENRKEFE 147 Query: 186 QHVQ 197 ++ + Sbjct: 148 KNAK 151 >UniRef50_Q5UQC9 Cluster: Probable ubiquitin-conjugating enzyme E2 L460; n=1; Acanthamoeba polyphaga mimivirus|Rep: Probable ubiquitin-conjugating enzyme E2 L460 - Mimivirus Length = 158 Score = 52.0 bits (119), Expect = 3e-06 Identities = 21/60 (35%), Positives = 40/60 (66%), Gaps = 1/60 (1%) Frame = +3 Query: 21 EGNVCLNILRED-WKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHVQ 197 +G++CLNIL++D W L + SI++ + L +PNPEDP N E A ++++ +++ ++ Sbjct: 87 KGDICLNILKKDGWNASLNIISIIWSIIVLLDQPNPEDPFNSELASLYRNDKLSYDKKIR 146 >UniRef50_UPI0000ECA0A1 Cluster: Ubiquitin-conjugating enzyme E2 T (EC 6.3.2.19) (Ubiquitin-protein ligase T) (Ubiquitin carrier protein T).; n=3; Amniota|Rep: Ubiquitin-conjugating enzyme E2 T (EC 6.3.2.19) (Ubiquitin-protein ligase T) (Ubiquitin carrier protein T). - Gallus gallus Length = 158 Score = 51.6 bits (118), Expect = 3e-06 Identities = 21/60 (35%), Positives = 39/60 (65%), Gaps = 4/60 (6%) Frame = +3 Query: 15 DLEGNVCLNILRED----WKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLF 182 D G +CL++L+ W+P L +++++ +Q L +EPNP+DPL + + E + N++LF Sbjct: 44 DSAGRICLDVLKLPPKGAWRPSLNISTLLTSIQLLMVEPNPDDPLMADISSEYKYNKQLF 103 >UniRef50_Q9C6Q4 Cluster: Ubiquitin carrier protein; n=10; Eukaryota|Rep: Ubiquitin carrier protein - Arabidopsis thaliana (Mouse-ear cress) Length = 195 Score = 51.6 bits (118), Expect = 3e-06 Identities = 24/62 (38%), Positives = 39/62 (62%) Frame = +3 Query: 15 DLEGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHV 194 D+ GN+CL+IL++ W V +I+ +Q L EPN PLN +AA +L SN+ + + V Sbjct: 128 DVYGNICLDILQDKWSSAYDVRTILLSIQSLLGEPNISSPLNTQAA-QLWSNQEEYRKMV 186 Query: 195 QR 200 ++ Sbjct: 187 EK 188 >UniRef50_Q9VYN3 Cluster: Ubiquitin carrier protein; n=2; Sophophora|Rep: Ubiquitin carrier protein - Drosophila melanogaster (Fruit fly) Length = 239 Score = 51.6 bits (118), Expect = 3e-06 Identities = 22/54 (40%), Positives = 33/54 (61%) Frame = +3 Query: 15 DLEGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRR 176 D G +CL++L E W PV+ V ++ + L E NP+DPL AD+ ++NRR Sbjct: 140 DSRGAICLDVLGERWSPVMNVAKVLLSIYVLMSECNPDDPLVMCIADQYKTNRR 193 >UniRef50_Q8IJ70 Cluster: Ubiquitin carrier protein; n=9; Aconoidasida|Rep: Ubiquitin carrier protein - Plasmodium falciparum (isolate 3D7) Length = 191 Score = 51.6 bits (118), Expect = 3e-06 Identities = 22/66 (33%), Positives = 39/66 (59%), Gaps = 1/66 (1%) Frame = +3 Query: 15 DLEGNVCLNILREDWKPVLT-VNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQH 191 + G+VCL+++ + W P+ + VN L L PNP DPLN +AA L ++ ++E+ Sbjct: 81 EASGSVCLDVINQTWTPLYSLVNVFEVFLPQLLTYPNPSDPLNSDAASLLMKDKNIYEEK 140 Query: 192 VQRAMR 209 V+ ++ Sbjct: 141 VKEYVK 146 >UniRef50_P16577 Cluster: Ubiquitin-conjugating enzyme E2-23 kDa; n=8; Eukaryota|Rep: Ubiquitin-conjugating enzyme E2-23 kDa - Triticum aestivum (Wheat) Length = 184 Score = 51.6 bits (118), Expect = 3e-06 Identities = 23/62 (37%), Positives = 36/62 (58%), Gaps = 1/62 (1%) Frame = +3 Query: 15 DLEGNVCLNILREDWKPVLT-VNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQH 191 ++ G+VCL+++ + W P+ VN L L L PNP DPLN EAA + ++ +E Sbjct: 79 EMSGSVCLDVINQTWSPMFDLVNIFEVFLPQLLLYPNPSDPLNGEAASLMMRDKNAYENK 138 Query: 192 VQ 197 V+ Sbjct: 139 VK 140 >UniRef50_Q7SXH5 Cluster: Ubiquitin carrier protein; n=9; Eukaryota|Rep: Ubiquitin carrier protein - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 147 Score = 51.2 bits (117), Expect = 4e-06 Identities = 20/50 (40%), Positives = 33/50 (66%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNR 173 G++CL+ILR W P LTV+ ++ + L +PNP+DPL + A +S++ Sbjct: 82 GSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAHIYKSDK 131 >UniRef50_Q6E683 Cluster: Ubiquitin carrier protein; n=1; Antonospora locustae|Rep: Ubiquitin carrier protein - Antonospora locustae (Nosema locustae) Length = 81 Score = 51.2 bits (117), Expect = 4e-06 Identities = 23/58 (39%), Positives = 33/58 (56%) Frame = +3 Query: 15 DLEGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQ 188 D+ GNVCL LR +W + + IV+G+ +EP+ E+ LN EA D L N F + Sbjct: 16 DINGNVCLEFLRHNWSCAMGIEWIVWGIYLFLIEPSGENALNTEAGDLLLYNYDKFAE 73 >UniRef50_A0C3F7 Cluster: Ubiquitin carrier protein; n=2; Paramecium tetraurelia|Rep: Ubiquitin carrier protein - Paramecium tetraurelia Length = 167 Score = 50.8 bits (116), Expect = 6e-06 Identities = 20/49 (40%), Positives = 33/49 (67%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSN 170 G VCL +L + W+P T+ S++ ++ + EPNP PLN +AA+ L++N Sbjct: 84 GEVCLEVLSQKWEPRWTIESVLRAVRLMLQEPNPYSPLNCDAANLLKAN 132 >UniRef50_Q5KIQ6 Cluster: Ubiquitin carrier protein; n=1; Filobasidiella neoformans|Rep: Ubiquitin carrier protein - Cryptococcus neoformans (Filobasidiella neoformans) Length = 260 Score = 50.8 bits (116), Expect = 6e-06 Identities = 20/51 (39%), Positives = 31/51 (60%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRR 176 G +CL++L+ W P L++ ++ L L +PNP DPL A E ++NRR Sbjct: 92 GAICLDLLKTAWSPALSLYKVILSLSSLLTDPNPADPLVPPIASEYRNNRR 142 >UniRef50_P52492 Cluster: Ubiquitin-conjugating enzyme E2-18 kDa; n=6; Eukaryota|Rep: Ubiquitin-conjugating enzyme E2-18 kDa - Saccharomyces cerevisiae (Baker's yeast) Length = 156 Score = 50.8 bits (116), Expect = 6e-06 Identities = 23/47 (48%), Positives = 29/47 (61%) Frame = +3 Query: 15 DLEGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAAD 155 D GN+CL+IL+E W V V +I+ LQ L EPN PLN AA+ Sbjct: 87 DKSGNICLDILKEKWSAVYNVETILLSLQSLLGEPNNRSPLNAVAAE 133 >UniRef50_UPI00015B62F0 Cluster: PREDICTED: hypothetical protein; n=1; Nasonia vitripennis|Rep: PREDICTED: hypothetical protein - Nasonia vitripennis Length = 154 Score = 50.4 bits (115), Expect = 8e-06 Identities = 20/66 (30%), Positives = 41/66 (62%), Gaps = 4/66 (6%) Frame = +3 Query: 15 DLEGNVCLNILRED----WKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLF 182 D +G +C+++L+ WKP +++ +++ +Q L PNP+DPL + A+E + N+ F Sbjct: 79 DTQGRICMDLLKMPPNGGWKPTISLENLIVAVQSLLGNPNPDDPLMVDIAEEYRFNKTEF 138 Query: 183 EQHVQR 200 E+ ++ Sbjct: 139 ERKAKK 144 >UniRef50_Q7QVX4 Cluster: Ubiquitin carrier protein; n=1; Giardia lamblia ATCC 50803|Rep: Ubiquitin carrier protein - Giardia lamblia ATCC 50803 Length = 192 Score = 50.4 bits (115), Expect = 8e-06 Identities = 26/76 (34%), Positives = 42/76 (55%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHVQRA 203 G+VCL+IL +WKP +T+ I+ GLQ L EPN + P EA + + + + ++ Sbjct: 95 GSVCLSILSYEWKPSITIKEILLGLQVLLDEPNLQSPAQHEAFQLRREDLTAYNKRIRAI 154 Query: 204 MRGGYVGTSYFERCLK 251 + +S FER +K Sbjct: 155 VEEN--PSSEFERRVK 168 >UniRef50_Q4Q3Q8 Cluster: Ubiquitin carrier protein; n=4; Leishmania|Rep: Ubiquitin carrier protein - Leishmania major Length = 243 Score = 50.4 bits (115), Expect = 8e-06 Identities = 19/42 (45%), Positives = 30/42 (71%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEA 149 G++C+N L+ DW P+L + I+ ++ L +EPNPE LN+EA Sbjct: 86 GDICVNTLKRDWSPMLGLRHILVVIRCLLIEPNPESALNEEA 127 >UniRef50_A2GNR9 Cluster: Ubiquitin conjugating protein, putative; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin conjugating protein, putative - Trichomonas vaginalis G3 Length = 151 Score = 50.4 bits (115), Expect = 8e-06 Identities = 22/63 (34%), Positives = 34/63 (53%) Frame = +3 Query: 30 VCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHVQRAMR 209 +CL+ILR +W P V++I+ +Q L EPNP N EA NR +E V++ + Sbjct: 86 ICLDILRRNWSPAYNVSAILLSIQQLLTEPNPAANANPEACQLYIHNRSEYEHRVRQCVE 145 Query: 210 GGY 218 + Sbjct: 146 DSW 148 >UniRef50_A2GLA4 Cluster: Ubiquitin-conjugating enzyme family protein; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin-conjugating enzyme family protein - Trichomonas vaginalis G3 Length = 157 Score = 50.4 bits (115), Expect = 8e-06 Identities = 22/71 (30%), Positives = 35/71 (49%) Frame = +3 Query: 15 DLEGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHV 194 D GNVC NIL +W P + +I+ + L +EPN +P N E A +N + + V Sbjct: 81 DANGNVCHNILFNEWDPSYNIYTILISIYLLIIEPNTNEPANPEIAQLYTNNNAEYNRMV 140 Query: 195 QRAMRGGYVGT 227 + ++ T Sbjct: 141 HECVENSWLTT 151 >UniRef50_A6RMU5 Cluster: Ubiquitin carrier protein; n=6; Ascomycota|Rep: Ubiquitin carrier protein - Botryotinia fuckeliana B05.10 Length = 223 Score = 50.4 bits (115), Expect = 8e-06 Identities = 22/60 (36%), Positives = 33/60 (55%) Frame = +3 Query: 15 DLEGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHV 194 D G +CL+IL++ W + +++ LQ L EPN PLN EAA+ N F++ V Sbjct: 154 DFSGRICLDILKDKWTAAYNIQTVLLSLQSLLGEPNNASPLNGEAAELWDKNPEEFQKKV 213 >UniRef50_Q95017 Cluster: SUMO-conjugating enzyme UBC9; n=7; Eukaryota|Rep: SUMO-conjugating enzyme UBC9 - Caenorhabditis elegans Length = 166 Score = 50.4 bits (115), Expect = 8e-06 Identities = 24/61 (39%), Positives = 36/61 (59%), Gaps = 2/61 (3%) Frame = +3 Query: 24 GNVCLNILRE--DWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHVQ 197 G VCL++L E DWKP +++ ++ G+Q L PN EDP EA NR +E+ V+ Sbjct: 90 GTVCLSLLDENKDWKPSISIKQLLIGIQDLLNHPNIEDPAQAEAYQIYCQNRAEYEKRVK 149 Query: 198 R 200 + Sbjct: 150 K 150 >UniRef50_UPI000155BB09 Cluster: PREDICTED: hypothetical protein; n=1; Ornithorhynchus anatinus|Rep: PREDICTED: hypothetical protein - Ornithorhynchus anatinus Length = 789 Score = 50.0 bits (114), Expect = 1e-05 Identities = 20/47 (42%), Positives = 31/47 (65%) Frame = +3 Query: 15 DLEGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAAD 155 D +GN+CL+IL++ W + V +I+ +Q L EPN + PLN AA+ Sbjct: 714 DAQGNICLDILKDKWSALYDVRTILLSIQSLLGEPNVDSPLNTHAAE 760 >UniRef50_Q9UTN8 Cluster: Ubiquitin conjugating enzyme Ubc14; n=1; Schizosaccharomyces pombe|Rep: Ubiquitin conjugating enzyme Ubc14 - Schizosaccharomyces pombe (Fission yeast) Length = 155 Score = 50.0 bits (114), Expect = 1e-05 Identities = 23/59 (38%), Positives = 39/59 (66%), Gaps = 1/59 (1%) Frame = +3 Query: 15 DLEGNVCLNILRED-WKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQ 188 D EGNVCL IL++ +KP + + S++ + L EPNP+DPL A++ +++R F++ Sbjct: 85 DSEGNVCLAILKQQVFKPSIKLRSVLEQILQLLREPNPDDPLVASIAEQYRNDRPSFDK 143 >UniRef50_Q4PH88 Cluster: Ubiquitin carrier protein; n=3; Dikarya|Rep: Ubiquitin carrier protein - Ustilago maydis (Smut fungus) Length = 227 Score = 50.0 bits (114), Expect = 1e-05 Identities = 21/55 (38%), Positives = 32/55 (58%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQ 188 G +CL+IL++ W PVLT+ S + L+ L P P DP + E A ++ FE+ Sbjct: 86 GAICLDILKDQWSPVLTLKSTLMSLRSLLCSPEPNDPQDAEVAKHYLRDKNDFEK 140 >UniRef50_P35128 Cluster: Ubiquitin-conjugating enzyme E2-17 kDa; n=30; Eukaryota|Rep: Ubiquitin-conjugating enzyme E2-17 kDa - Drosophila melanogaster (Fruit fly) Length = 151 Score = 50.0 bits (114), Expect = 1e-05 Identities = 18/47 (38%), Positives = 30/47 (63%) Frame = +3 Query: 15 DLEGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAAD 155 D G +CL++L++ W P L + +I+ +Q L PNP+DPL + A+ Sbjct: 81 DRLGRICLDVLKDKWSPALQIRTILLSIQALLSAPNPDDPLANDVAE 127 >UniRef50_Q24HQ3 Cluster: Ubiquitin carrier protein; n=1; Tetrahymena thermophila SB210|Rep: Ubiquitin carrier protein - Tetrahymena thermophila SB210 Length = 601 Score = 49.6 bits (113), Expect = 1e-05 Identities = 19/56 (33%), Positives = 33/56 (58%) Frame = +3 Query: 21 EGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQ 188 +G +C++IL+++W P LT+ ++ + L L PNP D L A E+ L++Q Sbjct: 489 QGRICIDILKDNWSPALTMAAVFNSISELMLHPNPIDALESNIAAEMNHEYDLYKQ 544 >UniRef50_A2FAR7 Cluster: Ubiquitin carrier protein; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin carrier protein - Trichomonas vaginalis G3 Length = 162 Score = 49.6 bits (113), Expect = 1e-05 Identities = 19/53 (35%), Positives = 33/53 (62%) Frame = +3 Query: 21 EGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRL 179 +G +CL+IL+ +W P T+NS+ ++ L P P+ PLN A + L+ N ++ Sbjct: 83 DGTICLDILKTEWTPAWTINSLCTAIRLLLSHPEPDSPLNTLAGNLLRYNDQI 135 >UniRef50_UPI00006CB320 Cluster: Ubiquitin-conjugating enzyme family protein; n=1; Tetrahymena thermophila SB210|Rep: Ubiquitin-conjugating enzyme family protein - Tetrahymena thermophila SB210 Length = 309 Score = 49.2 bits (112), Expect = 2e-05 Identities = 24/59 (40%), Positives = 35/59 (59%), Gaps = 1/59 (1%) Frame = +3 Query: 24 GNVCLNILREDWKPVLT-VNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHVQ 197 G+VCL+++ + W P+ +N L L PNP+DPLN EAA L ++ +F Q VQ Sbjct: 84 GSVCLDVINQTWSPMYELINIFDIFLPQLLTYPNPKDPLNPEAAMILIKDQNIFNQVVQ 142 >UniRef50_P21734 Cluster: Ubiquitin-conjugating enzyme E2-24 kDa; n=13; Ascomycota|Rep: Ubiquitin-conjugating enzyme E2-24 kDa - Saccharomyces cerevisiae (Baker's yeast) Length = 215 Score = 49.2 bits (112), Expect = 2e-05 Identities = 21/55 (38%), Positives = 30/55 (54%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQ 188 G +CL+IL+ W PV+T+ S + LQ L P P DP + E A +R F + Sbjct: 85 GAICLDILKNAWSPVITLKSALISLQALLQSPEPNDPQDAEVAQHYLRDRESFNK 139 >UniRef50_Q57XM0 Cluster: Ubiquitin carrier protein; n=1; Trypanosoma brucei|Rep: Ubiquitin carrier protein - Trypanosoma brucei Length = 226 Score = 48.8 bits (111), Expect = 2e-05 Identities = 21/61 (34%), Positives = 36/61 (59%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHVQRA 203 G++CL+ L++ W P L+V S++ + L +PNP N EAA +R +E+ V+R Sbjct: 145 GDICLDTLKDKWCPSLSVESVLLMIISLLSDPNPNSAANAEAASMYVQSRDKYEERVRRV 204 Query: 204 M 206 + Sbjct: 205 V 205 >UniRef50_A7RL90 Cluster: Predicted protein; n=2; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 209 Score = 48.8 bits (111), Expect = 2e-05 Identities = 22/60 (36%), Positives = 35/60 (58%), Gaps = 4/60 (6%) Frame = +3 Query: 15 DLEGNVCLNILRED----WKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLF 182 D G +CL+ L+ WKP L ++S++ + L EPNP+DPL E ++E + N+ F Sbjct: 81 DSSGRICLDTLKMPPKGMWKPALNISSVLSTILILMAEPNPDDPLMAEISNEFKYNKAQF 140 >UniRef50_A5E394 Cluster: Putative uncharacterized protein; n=1; Lodderomyces elongisporus NRRL YB-4239|Rep: Putative uncharacterized protein - Lodderomyces elongisporus (Yeast) (Saccharomyces elongisporus) Length = 199 Score = 48.8 bits (111), Expect = 2e-05 Identities = 21/58 (36%), Positives = 34/58 (58%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHVQ 197 G +CL+IL+ W P + S+V + L P P+ PLN +AA+ ++++ FE VQ Sbjct: 93 GEICLDILKSQWSPAWNLESLVVAILQLMDHPEPDSPLNIDAANLYRADKLGFESLVQ 150 >UniRef50_Q16763 Cluster: Ubiquitin-conjugating enzyme E2 S; n=33; Eumetazoa|Rep: Ubiquitin-conjugating enzyme E2 S - Homo sapiens (Human) Length = 222 Score = 48.8 bits (111), Expect = 2e-05 Identities = 21/60 (35%), Positives = 35/60 (58%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHVQRA 203 G +C+N+L+ DW L + ++ ++ L + PNPE LN+EA L N +E++ RA Sbjct: 92 GEICVNVLKRDWTAELGIRHVLLTIKCLLIHPNPESALNEEAGRLLLEN---YEEYAARA 148 >UniRef50_Q9FI61 Cluster: Ubiquitin carrier protein; n=3; Viridiplantae|Rep: Ubiquitin carrier protein - Arabidopsis thaliana (Mouse-ear cress) Length = 192 Score = 48.4 bits (110), Expect = 3e-05 Identities = 18/53 (33%), Positives = 32/53 (60%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLF 182 G +CL+IL++ W P LT+ + + +Q L P P+DP + A++ N ++F Sbjct: 85 GAICLDILKDQWSPALTLKTALVSIQALLSAPEPKDPQDAVVAEQYMKNYQVF 137 >UniRef50_Q6LFK4 Cluster: Ubiquitin-conjugating enzyme E2, putative; n=5; Plasmodium|Rep: Ubiquitin-conjugating enzyme E2, putative - Plasmodium falciparum (isolate 3D7) Length = 155 Score = 48.4 bits (110), Expect = 3e-05 Identities = 18/48 (37%), Positives = 32/48 (66%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQS 167 G +C++IL+ +W P T+ S+ + +LF EPN + PLN +A + ++S Sbjct: 83 GELCMDILKANWSPAWTIQSLCRAILFLFNEPNADSPLNCDAGNLIRS 130 >UniRef50_Q5DI37 Cluster: Ubiquitin carrier protein; n=2; Schistosoma japonicum|Rep: Ubiquitin carrier protein - Schistosoma japonicum (Blood fluke) Length = 203 Score = 48.4 bits (110), Expect = 3e-05 Identities = 20/42 (47%), Positives = 29/42 (69%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEA 149 G VC+N L++DWK L + I+ ++ L +EPNPE LN+EA Sbjct: 89 GEVCVNTLKKDWKSNLGLRHILLTIRCLLIEPNPESALNEEA 130 >UniRef50_A6SKB5 Cluster: Putative uncharacterized protein; n=2; Sclerotiniaceae|Rep: Putative uncharacterized protein - Botryotinia fuckeliana B05.10 Length = 153 Score = 48.4 bits (110), Expect = 3e-05 Identities = 20/55 (36%), Positives = 38/55 (69%), Gaps = 1/55 (1%) Frame = +3 Query: 9 TRDLEGNVCLNILRED-WKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSN 170 T D +G++C++ L++D WKP + +I+ ++ L + PNP+DPL AD+L+++ Sbjct: 80 TFDEKGSICVDELKQDKWKPSGKITAILGAIRNLLITPNPDDPLENTIADKLKND 134 >UniRef50_A3C6U5 Cluster: Ubiquitin carrier protein; n=2; Oryza sativa|Rep: Ubiquitin carrier protein - Oryza sativa subsp. japonica (Rice) Length = 191 Score = 48.0 bits (109), Expect = 4e-05 Identities = 21/39 (53%), Positives = 27/39 (69%), Gaps = 2/39 (5%) Frame = +3 Query: 24 GNVCLNILRED--WKPVLTVNSIVYGLQYLFLEPNPEDP 134 G VCL+IL ED W+P +TV I+ G+Q L +PNP DP Sbjct: 122 GTVCLSILNEDSGWRPAITVKQILVGIQDLLDQPNPADP 160 >UniRef50_Q586X5 Cluster: Ubiquitin carrier protein; n=3; Trypanosoma|Rep: Ubiquitin carrier protein - Trypanosoma brucei Length = 251 Score = 48.0 bits (109), Expect = 4e-05 Identities = 18/44 (40%), Positives = 31/44 (70%) Frame = +3 Query: 21 EGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAA 152 +G++C+N+L+ DW P L + ++ ++ L +EPN E LN+EAA Sbjct: 85 KGDICVNVLKRDWNPSLGLRHVLTIVRCLLIEPNAESALNEEAA 128 >UniRef50_Q4PA94 Cluster: Ubiquitin carrier protein; n=11; Eukaryota|Rep: Ubiquitin carrier protein - Ustilago maydis (Smut fungus) Length = 372 Score = 48.0 bits (109), Expect = 4e-05 Identities = 23/62 (37%), Positives = 34/62 (54%), Gaps = 1/62 (1%) Frame = +3 Query: 15 DLEGNVCLNILREDWKPVLT-VNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQH 191 +L G+VCL+++ + W P+ +N L L PNP DPLN EAA L + +E Sbjct: 265 ELSGSVCLDVINQTWSPMFDCINIFEVFLPQLLRYPNPTDPLNGEAAALLMREPKTYEAR 324 Query: 192 VQ 197 V+ Sbjct: 325 VK 326 >UniRef50_Q4DVH2 Cluster: Ubiquitin carrier protein; n=2; Trypanosoma cruzi|Rep: Ubiquitin carrier protein - Trypanosoma cruzi Length = 224 Score = 47.6 bits (108), Expect = 5e-05 Identities = 20/60 (33%), Positives = 36/60 (60%) Frame = +3 Query: 18 LEGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHVQ 197 ++GN+CL+ L+ +W P+L V S++ + L +PNP N EAA + + +E+ V+ Sbjct: 148 VDGNICLDTLKTEWSPILDVESLLMMIISLLSDPNPSSAANGEAALLYTNAKDKYEERVR 207 >UniRef50_A7STQ7 Cluster: Predicted protein; n=2; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 130 Score = 47.6 bits (108), Expect = 5e-05 Identities = 26/75 (34%), Positives = 42/75 (56%), Gaps = 2/75 (2%) Frame = +3 Query: 30 VCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNK--EAADELQSNRRLFEQHVQRA 203 VC+++L +DW+ + +V GL +LF PN EDPL+ E E + FE++V+ + Sbjct: 55 VCMSLL-DDWQASNDLEDLVQGLLFLFYNPNLEDPLSSLFEEESEEEYEYGSFEENVRAS 113 Query: 204 MRGGYVGTSYFERCL 248 + G V F+R L Sbjct: 114 LEGKTVAGENFQRVL 128 >UniRef50_Q4WU34 Cluster: Ubiquitin carrier protein; n=16; Pezizomycotina|Rep: Ubiquitin carrier protein - Aspergillus fumigatus (Sartorya fumigata) Length = 272 Score = 47.6 bits (108), Expect = 5e-05 Identities = 22/55 (40%), Positives = 30/55 (54%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQ 188 G +CL+ L W PVLT+ S + LQ L P P+DP + E A L + FE+ Sbjct: 87 GAICLDTLSSAWSPVLTIKSALLSLQSLLSTPEPKDPQDAEVATMLLRRPKEFER 141 >UniRef50_Q9FF66 Cluster: Ubiquitin carrier protein; n=8; Viridiplantae|Rep: Ubiquitin carrier protein - Arabidopsis thaliana (Mouse-ear cress) Length = 251 Score = 47.2 bits (107), Expect = 7e-05 Identities = 19/58 (32%), Positives = 34/58 (58%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHVQ 197 G +C+N L++DW P L + ++ ++ L +EP PE LN++A L N + +H + Sbjct: 91 GEICVNTLKKDWNPSLGLRHVLSVVRCLLIEPFPESALNEQAGKMLLENYDEYARHAR 148 >UniRef50_Q4CQP3 Cluster: Ubiquitin carrier protein; n=4; Trypanosomatidae|Rep: Ubiquitin carrier protein - Trypanosoma cruzi Length = 238 Score = 47.2 bits (107), Expect = 7e-05 Identities = 22/61 (36%), Positives = 35/61 (57%), Gaps = 2/61 (3%) Frame = +3 Query: 24 GNVCLNILRE--DWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHVQ 197 G VCL+IL E DW+P +T+ I+ +Q L PN +DP +E +R+ +E V+ Sbjct: 167 GTVCLSILNEEKDWRPSITIKQILLAIQELLDNPNIKDPAQEEPYKVYMRDRKEYEDRVR 226 Query: 198 R 200 + Sbjct: 227 Q 227 >UniRef50_A2F4E2 Cluster: Ubiquitin carrier protein; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin carrier protein - Trichomonas vaginalis G3 Length = 150 Score = 47.2 bits (107), Expect = 7e-05 Identities = 21/61 (34%), Positives = 37/61 (60%) Frame = +3 Query: 21 EGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHVQR 200 EGN+CL++L+ +W P + + I+ + L P+P D LN E A E + N +++V++ Sbjct: 83 EGNICLSLLKNEWSPKVKIMDILEQVYLLISAPDPIDALNTEIAAEYKDNH---DEYVRK 139 Query: 201 A 203 A Sbjct: 140 A 140 >UniRef50_A2F262 Cluster: Ubiquitin carrier protein; n=3; Eukaryota|Rep: Ubiquitin carrier protein - Trichomonas vaginalis G3 Length = 150 Score = 47.2 bits (107), Expect = 7e-05 Identities = 20/58 (34%), Positives = 33/58 (56%) Frame = +3 Query: 15 DLEGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQ 188 D G +CL+IL+ +W PV+ + + V +Q L EP EDPL + ++R+ E+ Sbjct: 80 DKLGRICLDILKTEWTPVMNIETTVLSIQSLMCEPCLEDPLETQICQHYVTDRKGAEE 137 >UniRef50_Q1DRT9 Cluster: Ubiquitin carrier protein; n=1; Coccidioides immitis|Rep: Ubiquitin carrier protein - Coccidioides immitis Length = 469 Score = 47.2 bits (107), Expect = 7e-05 Identities = 19/58 (32%), Positives = 32/58 (55%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHVQ 197 G VC++ L+ DW+P LT+ ++ + L + PNP+ LN A LQ + F + + Sbjct: 97 GAVCVDTLKRDWEPKLTLRDVLITISCLLIHPNPDSALNSAAGALLQDDYEAFARQAK 154 >UniRef50_A5DB66 Cluster: Ubiquitin carrier protein; n=1; Pichia guilliermondii|Rep: Ubiquitin carrier protein - Pichia guilliermondii (Yeast) (Candida guilliermondii) Length = 439 Score = 47.2 bits (107), Expect = 7e-05 Identities = 21/59 (35%), Positives = 34/59 (57%), Gaps = 1/59 (1%) Frame = +3 Query: 24 GNVCLNILR-EDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHVQ 197 G +CL+IL+ E W P T+ +V + L +P P+ PLN + A+ + ++ FE VQ Sbjct: 93 GEICLDILKSESWSPAWTIEYVVVAILMLIDDPEPDSPLNLDLANLFRYDKDAFESMVQ 151 >UniRef50_Q9NPD8 Cluster: Ubiquitin-conjugating enzyme E2 T; n=16; Coelomata|Rep: Ubiquitin-conjugating enzyme E2 T - Homo sapiens (Human) Length = 197 Score = 47.2 bits (107), Expect = 7e-05 Identities = 20/66 (30%), Positives = 39/66 (59%), Gaps = 4/66 (6%) Frame = +3 Query: 15 DLEGNVCLNILRED----WKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLF 182 D G +CL++L+ W+P L + +++ +Q L EPNP+DPL + + E + N+ F Sbjct: 80 DSAGRICLDVLKLPPKGAWRPSLNIATVLTSIQLLMSEPNPDDPLMADISSEFKYNKPAF 139 Query: 183 EQHVQR 200 ++ ++ Sbjct: 140 LKNARQ 145 >UniRef50_P42750 Cluster: Ubiquitin-conjugating enzyme E2-21 kDa 3; n=10; Eukaryota|Rep: Ubiquitin-conjugating enzyme E2-21 kDa 3 - Arabidopsis thaliana (Mouse-ear cress) Length = 183 Score = 47.2 bits (107), Expect = 7e-05 Identities = 23/59 (38%), Positives = 32/59 (54%), Gaps = 1/59 (1%) Frame = +3 Query: 24 GNVCLNILREDWKPVLT-VNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHVQ 197 G VCL+++ + W P+ +N L L L PNP DP N EAA L +R +E V+ Sbjct: 82 GAVCLDVINQTWSPMFDLINVFESFLPQLLLYPNPSDPFNGEAASLLMRDRAAYELKVK 140 >UniRef50_Q96LR5 Cluster: Ubiquitin-conjugating enzyme E2 E2; n=112; Eukaryota|Rep: Ubiquitin-conjugating enzyme E2 E2 - Homo sapiens (Human) Length = 201 Score = 47.2 bits (107), Expect = 7e-05 Identities = 18/51 (35%), Positives = 32/51 (62%) Frame = +3 Query: 21 EGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNR 173 +G +CL+IL+++W P LT++ ++ + L + NP DPL A + +NR Sbjct: 135 QGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNR 185 >UniRef50_P28263 Cluster: Ubiquitin-conjugating enzyme E2-24 kDa; n=13; Eukaryota|Rep: Ubiquitin-conjugating enzyme E2-24 kDa - Saccharomyces cerevisiae (Baker's yeast) Length = 218 Score = 46.8 bits (106), Expect = 1e-04 Identities = 19/59 (32%), Positives = 36/59 (61%), Gaps = 1/59 (1%) Frame = +3 Query: 24 GNVCLNILREDWKPVLT-VNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHVQ 197 G++CL+++ W P+ +N + + + L EPN DPLN EAA +++L+E+ ++ Sbjct: 82 GSICLDVINSTWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAATLQLRDKKLYEEKIK 140 >UniRef50_Q8SR07 Cluster: UBIQUITIN CONJUGATING ENZYME E2-20K; n=1; Encephalitozoon cuniculi|Rep: UBIQUITIN CONJUGATING ENZYME E2-20K - Encephalitozoon cuniculi Length = 151 Score = 46.4 bits (105), Expect = 1e-04 Identities = 22/52 (42%), Positives = 31/52 (59%) Frame = +3 Query: 15 DLEGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSN 170 D +GNVC+ ILR W+P + SI L +F+E ED LN +A D +S+ Sbjct: 88 DDDGNVCMEILRLGWRPSHGLESIFVNLYVIFVEVTGEDALNTKAGDLFKSD 139 >UniRef50_A7TMT8 Cluster: Putative uncharacterized protein; n=1; Vanderwaltozyma polyspora DSM 70294|Rep: Putative uncharacterized protein - Vanderwaltozyma polyspora DSM 70294 Length = 223 Score = 46.4 bits (105), Expect = 1e-04 Identities = 21/59 (35%), Positives = 36/59 (61%), Gaps = 1/59 (1%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIV-YGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHVQ 197 G++CL+++ W P+ + +IV + + L EPN DPLN EAA ++ L+EQ ++ Sbjct: 83 GSICLDVINSTWSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAAGLQLHDKTLYEQKIK 141 >UniRef50_P61086 Cluster: Ubiquitin-conjugating enzyme E2-25 kDa (EC 6.3.2.19) (Ubiquitin- protein ligase) (Ubiquitin carrier protein) (E2(25K)); n=43; Eumetazoa|Rep: Ubiquitin-conjugating enzyme E2-25 kDa (EC 6.3.2.19) (Ubiquitin- protein ligase) (Ubiquitin carrier protein) (E2(25K)) - Homo sapiens (Human) Length = 200 Score = 46.4 bits (105), Expect = 1e-04 Identities = 17/55 (30%), Positives = 33/55 (60%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQ 188 G +CL+IL++ W +T+ +++ LQ L P+DP + A++ + N +F+Q Sbjct: 89 GAICLDILKDQWAAAMTLRTVLLSLQALLAAAEPDDPQDAVVANQYKQNPEMFKQ 143 >UniRef50_UPI00015B555D Cluster: PREDICTED: similar to ubiquitin-conjugating enzyme UbcD2; n=3; Coelomata|Rep: PREDICTED: similar to ubiquitin-conjugating enzyme UbcD2 - Nasonia vitripennis Length = 176 Score = 46.0 bits (104), Expect = 2e-04 Identities = 18/51 (35%), Positives = 31/51 (60%) Frame = +3 Query: 21 EGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNR 173 +G +CL+IL+++W P LT++ ++ + L + NP DPL A + NR Sbjct: 110 QGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYLQNR 160 >UniRef50_UPI00006CC0C2 Cluster: Ubiquitin-conjugating enzyme family protein; n=1; Tetrahymena thermophila SB210|Rep: Ubiquitin-conjugating enzyme family protein - Tetrahymena thermophila SB210 Length = 579 Score = 46.0 bits (104), Expect = 2e-04 Identities = 18/56 (32%), Positives = 32/56 (57%) Frame = +3 Query: 21 EGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQ 188 +G++CL+IL++ W P LT+ + L +PNP D L+ A + + +F+Q Sbjct: 473 QGHMCLDILKDQWSPALTIQKSLNSFLSLMQDPNPNDALDSTIAAQYLDDINIFKQ 528 >UniRef50_UPI00006CB812 Cluster: Ubiquitin-conjugating enzyme family protein; n=2; Tetrahymena thermophila SB210|Rep: Ubiquitin-conjugating enzyme family protein - Tetrahymena thermophila SB210 Length = 901 Score = 46.0 bits (104), Expect = 2e-04 Identities = 16/48 (33%), Positives = 31/48 (64%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQS 167 G +CLN+++++W P T+ ++ +Q L PN + PLN +A + ++S Sbjct: 819 GEICLNVVKDEWSPYWTLEALCRAVQQLMSNPNADSPLNCDAGNLVRS 866 >UniRef50_A2AX46 Cluster: Ubiquitin carrier protein; n=2; Eukaryota|Rep: Ubiquitin carrier protein - Guillardia theta (Cryptomonas phi) Length = 201 Score = 46.0 bits (104), Expect = 2e-04 Identities = 20/50 (40%), Positives = 31/50 (62%) Frame = +3 Query: 57 WKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHVQRAM 206 W PV TV +IV + + +P + P N EAA EL++N L++QHV + + Sbjct: 146 WNPVHTVETIVLSVISMLSDPTDDSPANVEAAVELRNNFNLYKQHVSKCV 195 >UniRef50_Q4QIK2 Cluster: Ubiquitin carrier protein; n=6; Trypanosomatidae|Rep: Ubiquitin carrier protein - Leishmania major Length = 182 Score = 46.0 bits (104), Expect = 2e-04 Identities = 19/48 (39%), Positives = 31/48 (64%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQS 167 GNVCL+IL++ W PV T++S+ + L EP + P N +A + L++ Sbjct: 107 GNVCLDILKKRWSPVWTLSSVCRAILNLLAEPESDSPFNCDAGNLLRA 154 >UniRef50_Q4QBT6 Cluster: Ubiquitin-conjugating enzyme-like protein; n=3; Leishmania|Rep: Ubiquitin-conjugating enzyme-like protein - Leishmania major Length = 260 Score = 46.0 bits (104), Expect = 2e-04 Identities = 17/60 (28%), Positives = 35/60 (58%) Frame = +3 Query: 18 LEGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHVQ 197 ++GN+C++ L+ W+ L + +++ +Q L +PNP N AA L NR +++ ++ Sbjct: 174 VDGNICMDTLKSSWQSSLNLEALLISIQSLLSDPNPLSAANGAAARLLTENRSAYDEKIR 233 >UniRef50_Q4N5Y1 Cluster: Ubiquitin carrier protein; n=3; Piroplasmida|Rep: Ubiquitin carrier protein - Theileria parva Length = 157 Score = 46.0 bits (104), Expect = 2e-04 Identities = 16/44 (36%), Positives = 28/44 (63%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAAD 155 G +C++IL+ +W P T+ + G+ Y+ PNP+ PLN +A + Sbjct: 85 GELCIDILKSNWSPAWTIQYLCRGVIYILSTPNPDSPLNCDAGN 128 >UniRef50_Q5BE71 Cluster: Ubiquitin carrier protein; n=2; Trichocomaceae|Rep: Ubiquitin carrier protein - Emericella nidulans (Aspergillus nidulans) Length = 488 Score = 46.0 bits (104), Expect = 2e-04 Identities = 20/58 (34%), Positives = 31/58 (53%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHVQ 197 G VC++ L+ DWK LT+ ++ + L + PNP+ LN A LQ N F + + Sbjct: 128 GAVCVDTLKRDWKSTLTLKDVLITISCLLIFPNPDSALNATAGALLQENYDAFARQAK 185 >UniRef50_Q5A339 Cluster: Ubiquitin carrier protein; n=2; Eukaryota|Rep: Ubiquitin carrier protein - Candida albicans (Yeast) Length = 219 Score = 46.0 bits (104), Expect = 2e-04 Identities = 21/44 (47%), Positives = 28/44 (63%), Gaps = 2/44 (4%) Frame = +3 Query: 24 GNVCLNILRE--DWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEA 149 G VCL+IL E DWKP +T+ I+ G+Q L PN E P ++A Sbjct: 150 GTVCLSILNESQDWKPAITLTQILLGVQELLDTPNKESPAQEDA 193 >UniRef50_Q9LV54 Cluster: Ubiquitin carrier protein; n=2; Arabidopsis thaliana|Rep: Ubiquitin carrier protein - Arabidopsis thaliana (Mouse-ear cress) Length = 409 Score = 45.6 bits (103), Expect = 2e-04 Identities = 21/61 (34%), Positives = 37/61 (60%), Gaps = 4/61 (6%) Frame = +3 Query: 15 DLEGNVCLNIL----REDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLF 182 D G +CL+IL + W+P L +++++ ++ L EPNP+D L E + E + NR+ F Sbjct: 93 DNSGRICLDILNLPPKGAWQPSLNISTVLTSMRLLLSEPNPDDGLMCEVSREYKYNRQTF 152 Query: 183 E 185 + Sbjct: 153 D 153 >UniRef50_P68036 Cluster: Ubiquitin-conjugating enzyme E2 L3; n=66; Eumetazoa|Rep: Ubiquitin-conjugating enzyme E2 L3 - Homo sapiens (Human) Length = 154 Score = 45.6 bits (103), Expect = 2e-04 Identities = 20/57 (35%), Positives = 32/57 (56%), Gaps = 1/57 (1%) Frame = +3 Query: 15 DLEGNVCLNILR-EDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLF 182 D +G VCL ++ E+WKP + ++ L L +P PE PL + A+E +R+ F Sbjct: 80 DEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKF 136 >UniRef50_UPI0000499A56 Cluster: ubiquitin-conjugating enzyme; n=1; Entamoeba histolytica HM-1:IMSS|Rep: ubiquitin-conjugating enzyme - Entamoeba histolytica HM-1:IMSS Length = 160 Score = 45.2 bits (102), Expect = 3e-04 Identities = 21/59 (35%), Positives = 32/59 (54%), Gaps = 2/59 (3%) Frame = +3 Query: 24 GNVCLNILRE--DWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHV 194 G +CL+IL E DWKP ++ I+ G+Q L PN E P + A D + + ++ V Sbjct: 90 GQICLSILNESYDWKPTTSIKQILVGVQDLLDNPNKESPAQQRANDYFVRDIKAYKMEV 148 >UniRef50_Q7QWW0 Cluster: Ubiquitin carrier protein; n=1; Giardia lamblia ATCC 50803|Rep: Ubiquitin carrier protein - Giardia lamblia ATCC 50803 Length = 292 Score = 45.2 bits (102), Expect = 3e-04 Identities = 21/61 (34%), Positives = 37/61 (60%), Gaps = 2/61 (3%) Frame = +3 Query: 21 EGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSN--RRLFEQHV 194 +G VCLN+LR+D++P T+ S++ + + EP E PLN +AA ++ ++ H+ Sbjct: 213 DGRVCLNLLRDDYEPSYTLVSLLMAILCVVEEPGLEHPLNLDAAKAVERGEWEKIVSAHL 272 Query: 195 Q 197 Q Sbjct: 273 Q 273 >UniRef50_Q54VW9 Cluster: Ubiquitin carrier protein; n=1; Dictyostelium discoideum AX4|Rep: Ubiquitin carrier protein - Dictyostelium discoideum AX4 Length = 185 Score = 45.2 bits (102), Expect = 3e-04 Identities = 21/47 (44%), Positives = 28/47 (59%), Gaps = 1/47 (2%) Frame = +3 Query: 24 GNVCLNILREDWKPVLT-VNSIVYGLQYLFLEPNPEDPLNKEAADEL 161 G+VCL+++ + W P+ +N L L L PNP DPLN EAA L Sbjct: 82 GSVCLDVINQTWSPMFDLINIFEIFLPQLLLYPNPTDPLNGEAASML 128 >UniRef50_A2D9T6 Cluster: Ubiquitin carrier protein; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin carrier protein - Trichomonas vaginalis G3 Length = 150 Score = 45.2 bits (102), Expect = 3e-04 Identities = 20/68 (29%), Positives = 39/68 (57%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHVQRA 203 G +CL++L + W P V S++ ++ +PNPE LN EA + ++N+ +++ V++ Sbjct: 82 GGICLDLLIDKWLPSYNVASLLVSIRSFLDDPNPEHGLNSEALEMFRNNKDGYKRTVRQY 141 Query: 204 MRGGYVGT 227 + GT Sbjct: 142 INSYANGT 149 >UniRef50_Q0JAS6 Cluster: Os04g0580400 protein; n=1; Oryza sativa (japonica cultivar-group)|Rep: Os04g0580400 protein - Oryza sativa subsp. japonica (Rice) Length = 139 Score = 44.8 bits (101), Expect = 4e-04 Identities = 19/34 (55%), Positives = 24/34 (70%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNP 125 G VCL+IL WKP +TV I+ G+Q LF +PNP Sbjct: 58 GAVCLSILSTAWKPSITVRQILIGIQELFDDPNP 91 >UniRef50_A2AX45 Cluster: Ubiquitin carrier protein; n=1; Guillardia theta|Rep: Ubiquitin carrier protein - Guillardia theta (Cryptomonas phi) Length = 256 Score = 44.8 bits (101), Expect = 4e-04 Identities = 22/48 (45%), Positives = 30/48 (62%), Gaps = 2/48 (4%) Frame = +3 Query: 15 DLE-GNVCLNILREDWKPVL-TVNSIVYGLQYLFLEPNPEDPLNKEAA 152 DL+ G+VCL+++ + WKP+ VN L L PNP DPLN +AA Sbjct: 144 DLQSGSVCLDVINQTWKPMFDLVNIFEVFLPQLLTYPNPSDPLNADAA 191 >UniRef50_Q54J12 Cluster: Ubiquitin carrier protein; n=1; Dictyostelium discoideum AX4|Rep: Ubiquitin carrier protein - Dictyostelium discoideum AX4 Length = 549 Score = 44.8 bits (101), Expect = 4e-04 Identities = 17/50 (34%), Positives = 28/50 (56%) Frame = +3 Query: 21 EGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSN 170 +GN+CL+IL++ W +T ++ + L PNP DPL+ A + N Sbjct: 471 DGNICLDILKDHWSAAITTEKVLLSIHSLLSNPNPMDPLDVVKAGIYRDN 520 >UniRef50_A2EFK5 Cluster: Ubiquitin carrier protein; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin carrier protein - Trichomonas vaginalis G3 Length = 160 Score = 44.8 bits (101), Expect = 4e-04 Identities = 20/65 (30%), Positives = 39/65 (60%) Frame = +3 Query: 15 DLEGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHV 194 D +G +C+N +R + P ++ I+ ++ +PNP+D LN+EAA ++S+ F+ V Sbjct: 86 DTDGTICINAIRGGYFPGQSLVQIIEEVKMALKDPNPDDYLNREAAQLMKSDIEQFKLVV 145 Query: 195 QRAMR 209 R ++ Sbjct: 146 SRQIQ 150 >UniRef50_Q6MYZ2 Cluster: Ubiquitin carrier protein; n=7; Trichocomaceae|Rep: Ubiquitin carrier protein - Aspergillus fumigatus (Sartorya fumigata) Length = 530 Score = 44.8 bits (101), Expect = 4e-04 Identities = 19/58 (32%), Positives = 31/58 (53%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHVQ 197 G VC++ L+ DWK LT+ ++ + L + PNP+ LN A LQ + F + + Sbjct: 189 GAVCVDTLKRDWKSTLTLKDVLVTISCLLIYPNPDSALNSTAGALLQEDYDAFARQAK 246 >UniRef50_Q1E8C5 Cluster: Ubiquitin carrier protein; n=9; Pezizomycotina|Rep: Ubiquitin carrier protein - Coccidioides immitis Length = 257 Score = 44.8 bits (101), Expect = 4e-04 Identities = 22/62 (35%), Positives = 34/62 (54%), Gaps = 1/62 (1%) Frame = +3 Query: 15 DLEGNVCLNILREDWKPVLT-VNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQH 191 +L G+VCL+++ + W P+ +N L L PNP DPLN +AA L + +E Sbjct: 151 ELSGSVCLDVINQTWSPMYDMINIFEVFLPQLLRYPNPSDPLNGDAAAVLLRDPSKYEAK 210 Query: 192 VQ 197 V+ Sbjct: 211 VR 212 >UniRef50_Q43780 Cluster: Ubiquitin carrier protein; n=15; Eukaryota|Rep: Ubiquitin carrier protein - Solanum lycopersicum (Tomato) (Lycopersicon esculentum) Length = 194 Score = 44.4 bits (100), Expect = 5e-04 Identities = 17/53 (32%), Positives = 29/53 (54%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLF 182 G +CL+IL++ W P LT+ + + +Q L P P+DP + A + + F Sbjct: 85 GAICLDILKDQWSPALTLKTALLSIQALLSAPEPDDPQDAVVAQQYLREHQTF 137 >UniRef50_Q5CQL8 Cluster: Ubiquitin carrier protein; n=2; Cryptosporidium|Rep: Ubiquitin carrier protein - Cryptosporidium parvum Iowa II Length = 197 Score = 44.4 bits (100), Expect = 5e-04 Identities = 18/60 (30%), Positives = 36/60 (60%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHVQRA 203 G +CL+IL++ W P LT+ +++ +Q L P P DP + A +S+ ++++++ A Sbjct: 89 GAICLDILKDAWSPALTLRTVMLSIQALLSSPEPNDPQDALVASLYKSD---YQEYIETA 145 >UniRef50_Q6BRS6 Cluster: Similarities with CA4803|CaPEX4 Candida albicans CaPEX4; n=4; Saccharomycetales|Rep: Similarities with CA4803|CaPEX4 Candida albicans CaPEX4 - Debaryomyces hansenii (Yeast) (Torulaspora hansenii) Length = 568 Score = 44.4 bits (100), Expect = 5e-04 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 1/62 (1%) Frame = +3 Query: 24 GNVCLNILRED-WKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHVQR 200 G +CL+IL+++ W P + +V + L +P P+ PLN + A+ + ++ FE VQ Sbjct: 94 GEICLDILKQEGWSPAWNLQYLVVAILMLIDDPEPDSPLNIDLANLFRQDKTAFESVVQY 153 Query: 201 AM 206 M Sbjct: 154 YM 155 >UniRef50_Q4PBN3 Cluster: Ubiquitin carrier protein; n=1; Ustilago maydis|Rep: Ubiquitin carrier protein - Ustilago maydis (Smut fungus) Length = 269 Score = 44.4 bits (100), Expect = 5e-04 Identities = 17/49 (34%), Positives = 32/49 (65%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSN 170 G++C++ L++DWK + I+ ++ L +EPNP+ L+ EA+ +Q N Sbjct: 143 GDICVSSLKKDWKKEYGIERILTTIKCLLIEPNPDSALDAEASRLMQEN 191 >UniRef50_Q9LQI1 Cluster: F15O4.3; n=1; Arabidopsis thaliana|Rep: F15O4.3 - Arabidopsis thaliana (Mouse-ear cress) Length = 123 Score = 44.0 bits (99), Expect = 7e-04 Identities = 20/60 (33%), Positives = 33/60 (55%), Gaps = 6/60 (10%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIV------YGLQYLFLEPNPEDPLNKEAADELQSNRRLFE 185 G++C++IL++ W P LTV ++ + L +PNP DPL E ++NR F+ Sbjct: 64 GSICIDILKDKWTPSLTVEKLINKSHVLLSITVLLADPNPNDPLVPEIGQLFKNNRFQFD 123 >UniRef50_Q9VGD6 Cluster: CG14739-PA; n=2; Sophophora|Rep: CG14739-PA - Drosophila melanogaster (Fruit fly) Length = 206 Score = 44.0 bits (99), Expect = 7e-04 Identities = 23/65 (35%), Positives = 34/65 (52%), Gaps = 1/65 (1%) Frame = +3 Query: 18 LEGNVCLNILREDWKPVLT-VNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHV 194 + G VC+N+L++ W VN L L PNP D LN AA ++ + +LF +HV Sbjct: 89 ITGLVCMNVLKQAWSSSYDLVNIFETFLPQLLRYPNPHDSLNHRAAAIMKHSEQLFREHV 148 Query: 195 QRAMR 209 M+ Sbjct: 149 ILCMK 153 >UniRef50_Q4QAG0 Cluster: Ubiquitin-conjugating enzyme E2, putative; n=3; Leishmania|Rep: Ubiquitin-conjugating enzyme E2, putative - Leishmania major Length = 192 Score = 44.0 bits (99), Expect = 7e-04 Identities = 24/67 (35%), Positives = 36/67 (53%), Gaps = 3/67 (4%) Frame = +3 Query: 30 VCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPL---NKEAADELQSNRRLFEQHVQR 200 VCL ++ +W+P T+ +V ++ LF PN +DPL K AA L+ FE +R Sbjct: 126 VCLG-MQTEWRPTCTIKDMVVAIEMLFALPNYDDPLPGVAKTAAQILKDEPSRFELIAKR 184 Query: 201 AMRGGYV 221 M G Y+ Sbjct: 185 WMGGNYI 191 >UniRef50_P52484 Cluster: Probable ubiquitin-conjugating enzyme E2 21; n=5; Caenorhabditis|Rep: Probable ubiquitin-conjugating enzyme E2 21 - Caenorhabditis elegans Length = 229 Score = 44.0 bits (99), Expect = 7e-04 Identities = 17/53 (32%), Positives = 30/53 (56%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLF 182 G +CL+IL++ W LT+ +++ LQ + P P DP + A + +N +F Sbjct: 118 GTICLDILKDKWTASLTLRTVLLSLQAMLCSPEPSDPQDAVVAKQFINNYPMF 170 >UniRef50_Q9LJD7 Cluster: Constitutive photomorphogenesis protein 10; n=41; Eukaryota|Rep: Constitutive photomorphogenesis protein 10 - Arabidopsis thaliana (Mouse-ear cress) Length = 182 Score = 44.0 bits (99), Expect = 7e-04 Identities = 15/40 (37%), Positives = 26/40 (65%) Frame = +3 Query: 15 DLEGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDP 134 D G++ +NILR+ W P LT+ ++ ++ +FL+P P P Sbjct: 114 DTAGDLSVNILRDSWSPALTITKVLQAIRSIFLKPEPYSP 153 >UniRef50_UPI00001628C0 Cluster: UBC7 (ubiquitin-conjugating enzyme 7); ubiquitin-protein ligase; n=1; Arabidopsis thaliana|Rep: UBC7 (ubiquitin-conjugating enzyme 7); ubiquitin-protein ligase - Arabidopsis thaliana Length = 198 Score = 43.6 bits (98), Expect = 9e-04 Identities = 22/53 (41%), Positives = 29/53 (54%) Frame = +3 Query: 51 EDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHVQRAMR 209 E W PV TV SI+ + + PN E P N EAA E + R F++ V R +R Sbjct: 140 ERWTPVHTVESIMLSIISMLSGPNDESPANVEAAKEWRDKRDEFKKKVSRCVR 192 >UniRef50_A2WYK3 Cluster: Ubiquitin carrier protein; n=2; Oryza sativa|Rep: Ubiquitin carrier protein - Oryza sativa subsp. indica (Rice) Length = 195 Score = 43.6 bits (98), Expect = 9e-04 Identities = 17/45 (37%), Positives = 27/45 (60%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADE 158 G +CL+IL++ W P LT+ + + LQ L P P+DP + A + Sbjct: 86 GAICLDILKDQWSPALTLKTALLSLQALLSAPAPDDPQDAVVAQQ 130 >UniRef50_Q4Q5L3 Cluster: Ubiquitin carrier protein; n=6; Trypanosomatidae|Rep: Ubiquitin carrier protein - Leishmania major Length = 234 Score = 43.6 bits (98), Expect = 9e-04 Identities = 21/55 (38%), Positives = 33/55 (60%), Gaps = 1/55 (1%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIV-YGLQYLFLEPNPEDPLNKEAADELQSNRRLFE 185 G+VCL+++ + W P+ + +I L L PNP DPLN +AA L ++R F+ Sbjct: 86 GSVCLDVINQTWTPMYQLENIFDVFLPQLLRYPNPSDPLNVQAAHLLHADRVGFD 140 >UniRef50_A7RLE1 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 178 Score = 43.6 bits (98), Expect = 9e-04 Identities = 20/61 (32%), Positives = 35/61 (57%), Gaps = 2/61 (3%) Frame = +3 Query: 24 GNVCLNIL--REDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHVQ 197 G VCL+++ +DWKP +T ++ G+Q L +PN ++P EA +R +E V+ Sbjct: 97 GTVCLSLIDKNKDWKPQVTAQQVLTGIQLLLADPNFQEPAQAEAFVIYTQSRLDYENKVK 156 Query: 198 R 200 + Sbjct: 157 Q 157 >UniRef50_A3FPP4 Cluster: Ubiquitin carrier protein; n=1; Cryptosporidium parvum Iowa II|Rep: Ubiquitin carrier protein - Cryptosporidium parvum Iowa II Length = 137 Score = 43.6 bits (98), Expect = 9e-04 Identities = 14/47 (29%), Positives = 31/47 (65%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQ 164 G VC+++++++W P T++++ + + +PNP PLN +A + L+ Sbjct: 68 GEVCIDVIKDNWTPAWTLHAVCRAIISILCDPNPNSPLNCDAGNILR 114 >UniRef50_A2EY78 Cluster: Ubiquitin carrier protein; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin carrier protein - Trichomonas vaginalis G3 Length = 144 Score = 43.6 bits (98), Expect = 9e-04 Identities = 18/55 (32%), Positives = 30/55 (54%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQ 188 G +CL+ L+ +WKP T+ + + +L PN + PL + E + +LFEQ Sbjct: 79 GQICLDQLKNEWKPTYTLKHAIEFIIFLLQNPNWDSPLMPQIGAEYAQDPKLFEQ 133 >UniRef50_A2DSA6 Cluster: Ubiquitin carrier protein; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin carrier protein - Trichomonas vaginalis G3 Length = 203 Score = 43.6 bits (98), Expect = 9e-04 Identities = 24/64 (37%), Positives = 37/64 (57%), Gaps = 3/64 (4%) Frame = +3 Query: 15 DLEGNVCLNILR-EDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADEL--QSNRRLFE 185 D +GNVCL+ LR E + ++++ L +L PNP DPL+ ADE+ +S + F Sbjct: 109 DEDGNVCLSTLRGETYLASTSIHAHYVALGFLLKNPNPSDPLDANIADEMLDESTKDNFP 168 Query: 186 QHVQ 197 HV+ Sbjct: 169 IHVK 172 >UniRef50_Q8LGF7 Cluster: Ubiquitin carrier protein; n=7; Eukaryota|Rep: Ubiquitin carrier protein - Arabidopsis thaliana (Mouse-ear cress) Length = 157 Score = 43.2 bits (97), Expect = 0.001 Identities = 17/48 (35%), Positives = 28/48 (58%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQS 167 G +CL+IL+ W P T+ S+ + L P P+ PLN ++ + L+S Sbjct: 87 GEICLDILKNAWSPAWTLQSVCRAIIALMAHPEPDSPLNCDSGNLLRS 134 >UniRef50_Q54F00 Cluster: Ubiquitin carrier protein; n=3; Eukaryota|Rep: Ubiquitin carrier protein - Dictyostelium discoideum AX4 Length = 292 Score = 43.2 bits (97), Expect = 0.001 Identities = 20/65 (30%), Positives = 38/65 (58%), Gaps = 4/65 (6%) Frame = +3 Query: 15 DLEGNVCLNILRE----DWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLF 182 D G +CL+IL+ +WKP L + +I+ ++ L PNP DPL ++ ++ ++N F Sbjct: 88 DTNGRICLDILKMPPSGEWKPSLNLLTILTSIRLLMSNPNPYDPLMQDISEIYKNNYNQF 147 Query: 183 EQHVQ 197 ++ + Sbjct: 148 FKNAE 152 >UniRef50_UPI0000D56950 Cluster: PREDICTED: similar to Ubiquitin-conjugating enzyme E2 T (Ubiquitin-protein ligase T) (Ubiquitin carrier protein T); n=1; Tribolium castaneum|Rep: PREDICTED: similar to Ubiquitin-conjugating enzyme E2 T (Ubiquitin-protein ligase T) (Ubiquitin carrier protein T) - Tribolium castaneum Length = 151 Score = 42.7 bits (96), Expect = 0.002 Identities = 19/65 (29%), Positives = 36/65 (55%), Gaps = 4/65 (6%) Frame = +3 Query: 15 DLEGNVCLNILRE----DWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLF 182 D G +CL++++ +W+P + + ++ ++ L PNPEDPL E A+E ++ F Sbjct: 79 DDNGRICLDLIKMPPKGNWRPTIGLEGLLIAIRMLLETPNPEDPLMAEIAEEYRNMNSEF 138 Query: 183 EQHVQ 197 + Q Sbjct: 139 VKKAQ 143 >UniRef50_UPI00005A4DED Cluster: PREDICTED: similar to ubiquitin-conjugating enzyme E2N; n=1; Canis lupus familiaris|Rep: PREDICTED: similar to ubiquitin-conjugating enzyme E2N - Canis familiaris Length = 284 Score = 42.7 bits (96), Expect = 0.002 Identities = 18/52 (34%), Positives = 33/52 (63%) Frame = +3 Query: 15 DLEGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSN 170 D G VCL+IL++ W P L + +++ +Q L NP+DPL K+ ++ +++ Sbjct: 169 DKLGRVCLDILKDKWSP-LQIRTVLLWIQALLSALNPDDPLAKDVVEQWKTS 219 >UniRef50_A0C0C6 Cluster: Chromosome undetermined scaffold_14, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_14, whole genome shotgun sequence - Paramecium tetraurelia Length = 150 Score = 42.7 bits (96), Expect = 0.002 Identities = 16/55 (29%), Positives = 31/55 (56%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQ 188 G +CL IL ++W P LT+ ++ + L +PNP PL ++ ++++ + Q Sbjct: 85 GQICLEILGQNWSPNLTIRKLLLSILALLYDPNPNSPLLEDVNTIFKNDKAAYLQ 139 >UniRef50_A4RG25 Cluster: Putative uncharacterized protein; n=4; Sordariomycetes|Rep: Putative uncharacterized protein - Magnaporthe grisea (Rice blast fungus) (Pyricularia grisea) Length = 166 Score = 42.7 bits (96), Expect = 0.002 Identities = 17/44 (38%), Positives = 26/44 (59%) Frame = +3 Query: 21 EGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAA 152 +G VCL++L+E W P +V V ++ L P P+ PLN + A Sbjct: 94 DGEVCLDLLKEAWTPAYSVLETVRAVRLLLATPEPDSPLNVDVA 137 >UniRef50_O14933 Cluster: Ubiquitin/ISG15-conjugating enzyme E2 L6; n=4; Homo/Pan/Gorilla group|Rep: Ubiquitin/ISG15-conjugating enzyme E2 L6 - Homo sapiens (Human) Length = 152 Score = 42.7 bits (96), Expect = 0.002 Identities = 21/62 (33%), Positives = 31/62 (50%), Gaps = 1/62 (1%) Frame = +3 Query: 15 DLEGNVCLNILR-EDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQH 191 D G +CL I+ E+WKP ++ L L PN +PL + AD L N LF ++ Sbjct: 79 DENGQICLPIISSENWKPCTKTCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKN 138 Query: 192 VQ 197 + Sbjct: 139 AE 140 >UniRef50_Q0JLE6 Cluster: Ubiquitin carrier protein; n=4; Magnoliophyta|Rep: Ubiquitin carrier protein - Oryza sativa subsp. japonica (Rice) Length = 556 Score = 42.3 bits (95), Expect = 0.002 Identities = 20/61 (32%), Positives = 36/61 (59%), Gaps = 4/61 (6%) Frame = +3 Query: 15 DLEGNVCLNIL----REDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLF 182 D G +CL+IL + W+P L + +++ + L +PNP+D L E + E + NR++F Sbjct: 89 DNGGRICLDILNLPPKGAWQPSLNIATVLTSIGLLLSDPNPDDGLMAEISREYKYNRQVF 148 Query: 183 E 185 + Sbjct: 149 D 149 >UniRef50_A2EHU5 Cluster: Ubiquitin carrier protein; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin carrier protein - Trichomonas vaginalis G3 Length = 173 Score = 42.3 bits (95), Expect = 0.002 Identities = 19/60 (31%), Positives = 31/60 (51%), Gaps = 4/60 (6%) Frame = +3 Query: 15 DLEGNVCLNILRED----WKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLF 182 D G +CL+ L+ W +++ ++ +Q L EPNP DPL+ + A E N+ F Sbjct: 83 DSSGRICLDFLKPQPQGKWTATVSLEMLLTQIQQLMAEPNPNDPLDTKIAQEFTENKAKF 142 >UniRef50_A0BKX8 Cluster: Chromosome undetermined scaffold_113, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_113, whole genome shotgun sequence - Paramecium tetraurelia Length = 155 Score = 42.3 bits (95), Expect = 0.002 Identities = 17/60 (28%), Positives = 35/60 (58%) Frame = +3 Query: 21 EGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHVQR 200 +G + LN L+++W + V ++ + LF +PNP++PLN + A + Q + + + Q+ Sbjct: 82 QGCIALNTLKKEWSESIGVKKMLLEILSLFQKPNPQNPLNLKLAQQYQEDCSEYYERAQQ 141 >UniRef50_Q8SRC0 Cluster: Ubiquitin carrier protein; n=1; Encephalitozoon cuniculi|Rep: Ubiquitin carrier protein - Encephalitozoon cuniculi Length = 171 Score = 42.3 bits (95), Expect = 0.002 Identities = 21/62 (33%), Positives = 34/62 (54%), Gaps = 1/62 (1%) Frame = +3 Query: 15 DLEGNVCLNILREDWKPVLTVNSIV-YGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQH 191 + G++CL++L + W P+ + +IV L L PN DPLN EA +NR + + Sbjct: 79 EASGSICLDVLNQIWSPIYDLLNIVDILLPQLLSYPNAADPLNCEAGSMYLNNREKYNEV 138 Query: 192 VQ 197 V+ Sbjct: 139 VR 140 >UniRef50_Q8SSK8 Cluster: UBIQUITIN CONJUGATING ENZYME E2; n=1; Encephalitozoon cuniculi|Rep: UBIQUITIN CONJUGATING ENZYME E2 - Encephalitozoon cuniculi Length = 204 Score = 41.5 bits (93), Expect = 0.004 Identities = 16/41 (39%), Positives = 26/41 (63%) Frame = +3 Query: 30 VCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAA 152 VCL+I+ + WKP L + +++ G+Q L PN P N +A+ Sbjct: 134 VCLDIIGDRWKPSLNIMNVLCGIQQLLGSPNTRSPANTDAS 174 >UniRef50_Q969M7 Cluster: NEDD8-conjugating enzyme UBE2F; n=34; Eumetazoa|Rep: NEDD8-conjugating enzyme UBE2F - Homo sapiens (Human) Length = 185 Score = 41.5 bits (93), Expect = 0.004 Identities = 24/64 (37%), Positives = 35/64 (54%), Gaps = 7/64 (10%) Frame = +3 Query: 24 GNVCLNILRED------WKPVLTVNSIVYGLQYLFLE-PNPEDPLNKEAADELQSNRRLF 182 G +CL++LRE W P T+ +V+GL LF + N +DPLN EAA+ ++ F Sbjct: 113 GEICLSLLREHSIDGTGWAPTRTLKDVVWGLNSLFTDLLNFDDPLNIEAAEHHLRDKEDF 172 Query: 183 EQHV 194 V Sbjct: 173 RNKV 176 >UniRef50_Q9QZU9 Cluster: Ubiquitin/ISG15-conjugating enzyme E2 L6; n=12; Mammalia|Rep: Ubiquitin/ISG15-conjugating enzyme E2 L6 - Mus musculus (Mouse) Length = 152 Score = 41.5 bits (93), Expect = 0.004 Identities = 20/60 (33%), Positives = 32/60 (53%), Gaps = 1/60 (1%) Frame = +3 Query: 21 EGNVCLNIL-REDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHVQ 197 +G VCL ++ E+WKP ++ L L +PN E+P+ E AD L N +F + + Sbjct: 81 DGLVCLPLISNENWKPYTKPYQVLEALNVLVSKPNLEEPVRLELADLLTQNPEMFRKKAE 140 >UniRef50_Q7R2Z1 Cluster: Ubiquitin carrier protein; n=1; Giardia lamblia ATCC 50803|Rep: Ubiquitin carrier protein - Giardia lamblia ATCC 50803 Length = 158 Score = 41.1 bits (92), Expect = 0.005 Identities = 17/45 (37%), Positives = 29/45 (64%), Gaps = 1/45 (2%) Frame = +3 Query: 24 GNVCLNIL-REDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAAD 155 G +CLNIL ++DW P +++ S+ + L PN + PLN +A++ Sbjct: 88 GEICLNILTKDDWSPAISLISLAQSIAGLCSAPNTDSPLNCDASN 132 >UniRef50_Q6C713 Cluster: Similarities with DEHA0D15444g Debaryomyces hansenii; n=1; Yarrowia lipolytica|Rep: Similarities with DEHA0D15444g Debaryomyces hansenii - Yarrowia lipolytica (Candida lipolytica) Length = 153 Score = 41.1 bits (92), Expect = 0.005 Identities = 15/44 (34%), Positives = 26/44 (59%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAAD 155 G VC+++L+ W P T++S + + P P+ PLN +AA+ Sbjct: 85 GEVCIDVLKTQWSPAWTISSACTAVSAMLSLPEPDSPLNIDAAN 128 >UniRef50_Q1EB54 Cluster: Ubiquitin-conjugating enzyme; n=7; Pezizomycotina|Rep: Ubiquitin-conjugating enzyme - Coccidioides immitis Length = 169 Score = 41.1 bits (92), Expect = 0.005 Identities = 21/64 (32%), Positives = 33/64 (51%), Gaps = 1/64 (1%) Frame = +3 Query: 24 GNVCLNILR-EDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHVQR 200 G +CL++L E W P T++S + + L +P PE PLN + A L+ L + + R Sbjct: 89 GEICLSLLTSEHWAPTYTLSSTLAAIHQLLSDPRPESPLNVDVAALLREGDLLGWESLVR 148 Query: 201 AMRG 212 G Sbjct: 149 YWTG 152 >UniRef50_UPI0001554972 Cluster: PREDICTED: similar to hCG2039566; n=1; Ornithorhynchus anatinus|Rep: PREDICTED: similar to hCG2039566 - Ornithorhynchus anatinus Length = 223 Score = 40.7 bits (91), Expect = 0.006 Identities = 22/51 (43%), Positives = 31/51 (60%), Gaps = 7/51 (13%) Frame = +3 Query: 24 GNVCLNILRED------WKPVLTVNSIVYGLQYLFLE-PNPEDPLNKEAAD 155 G +CL++LRE W P T+ +V+GL LF + N +DPLN EAA+ Sbjct: 77 GEICLSLLREHSIDGTGWAPTRTLKDVVWGLNSLFTDLLNFDDPLNIEAAE 127 >UniRef50_Q0R0E6 Cluster: Ubiquitin carrier protein; n=1; Symbiodinium sp. C3|Rep: Ubiquitin carrier protein - Symbiodinium sp. C3 Length = 268 Score = 40.7 bits (91), Expect = 0.006 Identities = 15/44 (34%), Positives = 28/44 (63%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAAD 155 G +CL+IL++ W P L+V + ++ L +PNP+D + + A+ Sbjct: 207 GAICLDILKDSWSPSLSVFKCLESIRALMADPNPDDAMRQWIAE 250 >UniRef50_Q54I43 Cluster: Ubiquitin carrier protein; n=3; Eukaryota|Rep: Ubiquitin carrier protein - Dictyostelium discoideum AX4 Length = 215 Score = 40.7 bits (91), Expect = 0.006 Identities = 18/59 (30%), Positives = 34/59 (57%) Frame = +3 Query: 21 EGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHVQ 197 +G +C+N L++DW L + I+ ++ L + PN E LN++A+ L N + +H + Sbjct: 89 KGEICVNTLKKDWTEDLGLKHILLTIKCLLIVPNAESSLNEDASRLLLENYDDYCKHAK 147 >UniRef50_Q8SS54 Cluster: Ubiquitin carrier protein; n=1; Encephalitozoon cuniculi|Rep: Ubiquitin carrier protein - Encephalitozoon cuniculi Length = 172 Score = 40.7 bits (91), Expect = 0.006 Identities = 26/73 (35%), Positives = 35/73 (47%), Gaps = 13/73 (17%) Frame = +3 Query: 15 DLEGNVCLNILR---ED----------WKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAAD 155 D GNVC++IL ED W PV T S++ + L PN E P N +AA Sbjct: 85 DENGNVCISILHNPGEDEYGYESLGDRWLPVRTPESVILSIITLLTSPNCESPANVDAAQ 144 Query: 156 ELQSNRRLFEQHV 194 L+ N R + + V Sbjct: 145 HLRENEREYRKKV 157 >UniRef50_A2FS62 Cluster: Ubiquitin carrier protein; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin carrier protein - Trichomonas vaginalis G3 Length = 149 Score = 40.3 bits (90), Expect = 0.008 Identities = 16/58 (27%), Positives = 31/58 (53%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHVQ 197 G++C++IL+++W +I+ + L + PNP P N EA + N + + V+ Sbjct: 84 GSICIDILQQNWSNAYDAAAIMTSIISLLVLPNPHSPANNEAGELYVKNTNEYNRRVK 141 >UniRef50_A0CD76 Cluster: Ubiquitin carrier protein; n=4; Paramecium tetraurelia|Rep: Ubiquitin carrier protein - Paramecium tetraurelia Length = 232 Score = 40.3 bits (90), Expect = 0.008 Identities = 19/62 (30%), Positives = 37/62 (59%), Gaps = 1/62 (1%) Frame = +3 Query: 21 EGNVCLNILREDWKPV-LTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHVQ 197 +G +C+N L++DW P+ ++ +I ++ L + P PE LN+EA N ++++ + Sbjct: 123 KGEICVNTLKKDWNPLQWSLKNIFEVIKCLLIVPFPESSLNEEAGKLFMEN---YDEYFK 179 Query: 198 RA 203 RA Sbjct: 180 RA 181 >UniRef50_A0BIB5 Cluster: Chromosome undetermined scaffold_11, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_11, whole genome shotgun sequence - Paramecium tetraurelia Length = 204 Score = 40.3 bits (90), Expect = 0.008 Identities = 16/42 (38%), Positives = 28/42 (66%), Gaps = 2/42 (4%) Frame = +3 Query: 27 NVCLNILREDWKPVLTVNSIVYGLQYL--FLEPNPEDPLNKE 146 ++CL++L++ W P L + SI+ +Q L + P+ +DPLN E Sbjct: 81 DICLDVLKDKWSPALQIRSILLQIQVLLSYTNPSMDDPLNIE 122 >UniRef50_Q4PGW5 Cluster: Ubiquitin carrier protein; n=2; Basidiomycota|Rep: Ubiquitin carrier protein - Ustilago maydis (Smut fungus) Length = 458 Score = 40.3 bits (90), Expect = 0.008 Identities = 22/69 (31%), Positives = 34/69 (49%), Gaps = 1/69 (1%) Frame = +3 Query: 15 DLEGNVCLNILR-EDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQH 191 D GN+C+ IL+ E WKP +I+ + L EPN +D L A+ +R F++ Sbjct: 80 DESGNLCVGILKSEAWKPSTKAVTILLSILQLLDEPNADDALVASIAELYNKDRAKFDKT 139 Query: 192 VQRAMRGGY 218 Q + Y Sbjct: 140 AQEYTKKRY 148 >UniRef50_A4GFM0 Cluster: Peroxin 4; n=1; Penicillium chrysogenum|Rep: Peroxin 4 - Penicillium chrysogenum (Penicillium notatum) Length = 164 Score = 40.3 bits (90), Expect = 0.008 Identities = 16/43 (37%), Positives = 26/43 (60%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAA 152 G +C + L DWKP + ++ I+ +Q L P+P+ PLN + A Sbjct: 94 GEICSS-LNNDWKPTVNLSGILAAIQLLLTVPDPDSPLNPDIA 135 >UniRef50_Q9AW53 Cluster: Ubiquitin carrier protein; n=1; Guillardia theta|Rep: Ubiquitin carrier protein - Guillardia theta (Cryptomonas phi) Length = 144 Score = 39.9 bits (89), Expect = 0.011 Identities = 17/48 (35%), Positives = 25/48 (52%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQS 167 G +CL+IL+ W P T+ + L P P PLN +A + L+S Sbjct: 84 GEICLDILKNQWTPAWTILFSCQAIIVLLTNPEPNSPLNCDAGNFLRS 131 >UniRef50_A2G420 Cluster: Ubiquitin carrier protein; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin carrier protein - Trichomonas vaginalis G3 Length = 175 Score = 39.9 bits (89), Expect = 0.011 Identities = 18/60 (30%), Positives = 32/60 (53%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHVQRA 203 G +C++ L DW + ++ ++ ++ L L+PNP LN+EA N +E + RA Sbjct: 88 GAICVSTLSSDWTEDMGLDHLLLSIKCLLLQPNPSSALNEEAGRLFSEN---YEDYCSRA 144 >UniRef50_A2EP72 Cluster: Ubiquitin carrier protein; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin carrier protein - Trichomonas vaginalis G3 Length = 170 Score = 39.9 bits (89), Expect = 0.011 Identities = 17/50 (34%), Positives = 31/50 (62%) Frame = +3 Query: 51 EDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHVQR 200 E W P+ TV SI+ + + +PNPE P+N EAA +++ +++ V++ Sbjct: 110 ERWLPIHTVESIIISVLSMLSDPNPESPMNIEAAKIYKNDIDEYKKRVRK 159 >UniRef50_Q0TZE7 Cluster: Ubiquitin carrier protein; n=1; Phaeosphaeria nodorum|Rep: Ubiquitin carrier protein - Phaeosphaeria nodorum (Septoria nodorum) Length = 465 Score = 39.9 bits (89), Expect = 0.011 Identities = 18/48 (37%), Positives = 27/48 (56%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQS 167 G VC+ L+ DW L + ++ + L ++PNP LN EAA +L S Sbjct: 127 GAVCVETLKRDWSSALKLRDVLVTISCLLIQPNPASALN-EAAGKLAS 173 >UniRef50_UPI00006CC8BE Cluster: Ubiquitin-conjugating enzyme family protein; n=1; Tetrahymena thermophila SB210|Rep: Ubiquitin-conjugating enzyme family protein - Tetrahymena thermophila SB210 Length = 147 Score = 39.5 bits (88), Expect = 0.015 Identities = 18/57 (31%), Positives = 33/57 (57%), Gaps = 1/57 (1%) Frame = +3 Query: 21 EGNVCLNILRE-DWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQ 188 +G VC +L E +W P V +++ + + EPN + +N EAA + +S+ + FE+ Sbjct: 79 KGEVCKEMLGEKEWVPTKQVKTVIEIIASMLAEPNVDSAINNEAAKQYKSDPKEFEK 135 >UniRef50_Q54P16 Cluster: Ubiquitin conjugating enzyme; n=2; Dictyostelium discoideum|Rep: Ubiquitin conjugating enzyme - Dictyostelium discoideum AX4 Length = 148 Score = 39.5 bits (88), Expect = 0.015 Identities = 14/56 (25%), Positives = 31/56 (55%) Frame = +3 Query: 21 EGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQ 188 +G +C + W P L + ++ ++ + +PNP++PL E A + +++R F + Sbjct: 83 DGAICAEVF-STWSPQLKILDVLTTIRSILTDPNPDNPLETEIAQQFKTDRNAFNK 137 >UniRef50_Q8IH42 Cluster: Ubiquitin carrier protein; n=15; Fungi/Metazoa group|Rep: Ubiquitin carrier protein - Drosophila melanogaster (Fruit fly) Length = 180 Score = 39.1 bits (87), Expect = 0.019 Identities = 19/53 (35%), Positives = 29/53 (54%) Frame = +3 Query: 51 EDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHVQRAMR 209 E W PV TV +I+ + + +PN E N +AA E + N F++ V R +R Sbjct: 121 ERWLPVHTVETILLSVISMLTDPNDESAANVDAAKEYRENYAEFKRKVTRCVR 173 >UniRef50_Q22BX5 Cluster: Ubiquitin carrier protein; n=5; Tetrahymena thermophila SB210|Rep: Ubiquitin carrier protein - Tetrahymena thermophila SB210 Length = 549 Score = 39.1 bits (87), Expect = 0.019 Identities = 16/42 (38%), Positives = 24/42 (57%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEA 149 G +CLNIL++ W VLT+ ++ + L E N +D N A Sbjct: 439 GEICLNILQDKWSTVLTIQKVLVSIVSLLYEKNLDDVYNHYA 480 >UniRef50_Q55U75 Cluster: Ubiquitin carrier protein; n=2; Filobasidiella neoformans|Rep: Ubiquitin carrier protein - Cryptococcus neoformans (Filobasidiella neoformans) Length = 246 Score = 39.1 bits (87), Expect = 0.019 Identities = 15/46 (32%), Positives = 28/46 (60%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADEL 161 G +C++ L++ WK V ++ ++ L + PNPE L++EA +L Sbjct: 87 GEICVDTLKKGWKKEYGVGHVLITIKCLLIFPNPESALDEEAGKQL 132 >UniRef50_UPI0000498C2E Cluster: ubiquitin-conjugating enzyme; n=3; Entamoeba histolytica HM-1:IMSS|Rep: ubiquitin-conjugating enzyme - Entamoeba histolytica HM-1:IMSS Length = 161 Score = 38.7 bits (86), Expect = 0.025 Identities = 18/50 (36%), Positives = 29/50 (58%), Gaps = 1/50 (2%) Frame = +3 Query: 24 GNVCLNILR-EDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSN 170 G +CL+ L+ + W + ++S++ +Q L PN EDPLN E + SN Sbjct: 93 GKICLDTLKPQGWVCAMQISSVLQTIQQLLANPNLEDPLNLEVNNLWLSN 142 >UniRef50_Q6CPL4 Cluster: Kluyveromyces lactis strain NRRL Y-1140 chromosome E of strain NRRL Y- 1140 of Kluyveromyces lactis; n=1; Kluyveromyces lactis|Rep: Kluyveromyces lactis strain NRRL Y-1140 chromosome E of strain NRRL Y- 1140 of Kluyveromyces lactis - Kluyveromyces lactis (Yeast) (Candida sphaerica) Length = 158 Score = 38.7 bits (86), Expect = 0.025 Identities = 15/58 (25%), Positives = 33/58 (56%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHVQ 197 G +CL++L++ W P+ T+ +V ++ L +P + PL+ + A ++ + Q V+ Sbjct: 90 GEICLDLLKDAWTPIYTLLDVVGAIRDLLADPGLDSPLDLDIAQIYDADYEAYVQIVR 147 >UniRef50_A7TL65 Cluster: Putative uncharacterized protein; n=1; Vanderwaltozyma polyspora DSM 70294|Rep: Putative uncharacterized protein - Vanderwaltozyma polyspora DSM 70294 Length = 323 Score = 38.7 bits (86), Expect = 0.025 Identities = 17/49 (34%), Positives = 27/49 (55%) Frame = +3 Query: 51 EDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHVQ 197 E W PV TV S++ + L +PN P N +AA + + N ++Q V+ Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNISSPANVDAAVDYRKNPEQYKQRVK 161 >UniRef50_P49428 Cluster: Ubiquitin-conjugating enzyme E2-24 kDa; n=2; Pichia|Rep: Ubiquitin-conjugating enzyme E2-24 kDa - Pichia pastoris (Yeast) Length = 204 Score = 38.7 bits (86), Expect = 0.025 Identities = 16/49 (32%), Positives = 29/49 (59%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSN 170 G +CL+IL+ W P T++S + + L +P P PL+ + A+ ++ N Sbjct: 130 GEICLDILQAKWTPAWTLSSALTAIVLLLNDPEPLSPLDIDMANLMKIN 178 >UniRef50_P14682 Cluster: Ubiquitin-conjugating enzyme E2-34 kDa; n=14; Ascomycota|Rep: Ubiquitin-conjugating enzyme E2-34 kDa - Saccharomyces cerevisiae (Baker's yeast) Length = 295 Score = 38.7 bits (86), Expect = 0.025 Identities = 17/49 (34%), Positives = 27/49 (55%) Frame = +3 Query: 51 EDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHVQ 197 E W PV TV S++ + L +PN P N +AA + + N ++Q V+ Sbjct: 113 ETWSPVQTVESVLISIVSLLEDPNINSPANVDAAVDYRKNPEQYKQRVK 161 >UniRef50_Q9XVK5 Cluster: NEDD8-conjugating enzyme ubc-12; n=3; Chromadorea|Rep: NEDD8-conjugating enzyme ubc-12 - Caenorhabditis elegans Length = 180 Score = 38.7 bits (86), Expect = 0.025 Identities = 22/66 (33%), Positives = 36/66 (54%), Gaps = 7/66 (10%) Frame = +3 Query: 21 EGNVCLNILRED------WKPVLTVNSIVYGLQYLFLE-PNPEDPLNKEAADELQSNRRL 179 +G++CL+ILR++ W+P + +V+GL LF + + D LN +AA NR Sbjct: 108 DGSICLSILRQNSLDQYGWRPTRNLTDVVHGLVSLFNDLMDFNDALNIQAAQMWSQNRES 167 Query: 180 FEQHVQ 197 F V+ Sbjct: 168 FNHRVR 173 >UniRef50_Q98S78 Cluster: Ubiquitin-conjugating enzyme E2-17 KD subunit; n=1; Guillardia theta|Rep: Ubiquitin-conjugating enzyme E2-17 KD subunit - Guillardia theta (Cryptomonas phi) Length = 147 Score = 38.3 bits (85), Expect = 0.034 Identities = 16/55 (29%), Positives = 30/55 (54%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQ 188 G VC++IL + W PV + +++ L+ L PN + P N A + ++L+ + Sbjct: 86 GKVCIDILNKKWSPVYSNITLLLSLKILLEFPNSDSPANLRATNLFIRKKKLYNK 140 >UniRef50_P62256 Cluster: Ubiquitin-conjugating enzyme E2 H; n=51; Eumetazoa|Rep: Ubiquitin-conjugating enzyme E2 H - Homo sapiens (Human) Length = 183 Score = 37.1 bits (82), Expect = 0.078 Identities = 17/47 (36%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = +3 Query: 15 DLEGNVCLNILREDWKPVLTVNSIVYG-LQYLFLEPNPEDPLNKEAA 152 + G VCL+++ + W + + +I L L PNP DPLN +AA Sbjct: 81 EASGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPIDPLNGDAA 127 >UniRef50_P62253 Cluster: Ubiquitin-conjugating enzyme E2 G1; n=66; Eukaryota|Rep: Ubiquitin-conjugating enzyme E2 G1 - Homo sapiens (Human) Length = 170 Score = 37.1 bits (82), Expect = 0.078 Identities = 24/79 (30%), Positives = 40/79 (50%), Gaps = 14/79 (17%) Frame = +3 Query: 15 DLEGNVCLNILRED-------------WKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAAD 155 D G+VC++IL E W P+ TV +I+ + + +PN + P N +AA Sbjct: 84 DKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETIMISVISMLADPNGDSPANVDAAK 143 Query: 156 ELQSNRR-LFEQHVQRAMR 209 E + +R F++ V R +R Sbjct: 144 EWREDRNGEFKRKVARCVR 162 >UniRef50_Q753J8 Cluster: AFR314Wp; n=1; Eremothecium gossypii|Rep: AFR314Wp - Ashbya gossypii (Yeast) (Eremothecium gossypii) Length = 155 Score = 36.7 bits (81), Expect = 0.10 Identities = 18/63 (28%), Positives = 33/63 (52%), Gaps = 1/63 (1%) Frame = +3 Query: 24 GNVCLNILR-EDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHVQR 200 G VCL++L+ E W PV + +V + L EP + PL+ + + ++R ++ V Sbjct: 88 GEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEPGVDSPLDVDLSRLYTTDRAAYDGVVNY 147 Query: 201 AMR 209 +R Sbjct: 148 RLR 150 >UniRef50_Q4U8F2 Cluster: Ubiquitin carrier protein; n=2; Piroplasmida|Rep: Ubiquitin carrier protein - Theileria annulata Length = 170 Score = 36.3 bits (80), Expect = 0.14 Identities = 16/53 (30%), Positives = 31/53 (58%) Frame = +3 Query: 51 EDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHVQRAMR 209 E W+P+L V +I+ + + EPN E P N +A +L+++ + + + V+ R Sbjct: 114 ERWRPILGVETILISVISMLGEPNLESPANVDAGVQLKNDPKEYRKKVKMLTR 166 >UniRef50_A2DRC1 Cluster: Ubiquitin carrier protein; n=1; Trichomonas vaginalis G3|Rep: Ubiquitin carrier protein - Trichomonas vaginalis G3 Length = 138 Score = 35.9 bits (79), Expect = 0.18 Identities = 15/35 (42%), Positives = 22/35 (62%) Frame = +3 Query: 45 LREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEA 149 L E W PV T+ +IV + + +PNP+ PLN +A Sbjct: 75 LNEKWLPVHTIETIVISVICMLGDPNPQSPLNVKA 109 >UniRef50_A0DYM1 Cluster: Chromosome undetermined scaffold_7, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_7, whole genome shotgun sequence - Paramecium tetraurelia Length = 1164 Score = 35.9 bits (79), Expect = 0.18 Identities = 16/54 (29%), Positives = 28/54 (51%) Frame = +3 Query: 21 EGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLF 182 +G +C +IL ++ P V I + L + P P+DPL+ A E + +L+ Sbjct: 1055 QGRICHSILGRNYTPDTKVIQIFEAVYGLLMTPEPDDPLDTTIASEYMQDLKLY 1108 >UniRef50_A3AAT7 Cluster: Putative uncharacterized protein; n=4; Oryza sativa|Rep: Putative uncharacterized protein - Oryza sativa subsp. japonica (Rice) Length = 416 Score = 35.5 bits (78), Expect = 0.24 Identities = 14/58 (24%), Positives = 31/58 (53%) Frame = +3 Query: 15 DLEGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQ 188 D +G + L+I +++W P LT+N ++ + +P + P N+ A + + +E+ Sbjct: 283 DGKGRMALDIFQDNWSPALTINKLLLCFVSVLFDPLLDRPTNRCIAKQYKHEYEAYEE 340 >UniRef50_Q2H4J3 Cluster: Putative uncharacterized protein; n=2; Fungi/Metazoa group|Rep: Putative uncharacterized protein - Chaetomium globosum (Soil fungus) Length = 113 Score = 35.5 bits (78), Expect = 0.24 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = +3 Query: 51 EDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAA 152 ++W P L + +I+ +Q L PNP+DPL + A Sbjct: 55 DNWSPALQIRTILLSIQALLGAPNPDDPLAADVA 88 >UniRef50_A7TP75 Cluster: Putative uncharacterized protein; n=1; Vanderwaltozyma polyspora DSM 70294|Rep: Putative uncharacterized protein - Vanderwaltozyma polyspora DSM 70294 Length = 157 Score = 35.5 bits (78), Expect = 0.24 Identities = 16/48 (33%), Positives = 28/48 (58%), Gaps = 1/48 (2%) Frame = +3 Query: 24 GNVCLNIL-REDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQ 164 G +CLNIL +W PV + ++V + L +P + PLN + ++ L+ Sbjct: 89 GKICLNILDNANWSPVWNLLTVVLAIYQLLSDPVTDSPLNIDLSNILK 136 >UniRef50_A3LYJ5 Cluster: Predicted protein; n=3; Saccharomycetales|Rep: Predicted protein - Pichia stipitis (Yeast) Length = 182 Score = 35.5 bits (78), Expect = 0.24 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIVYGLQ 101 G++CLN+L EDW P ++ S++ +Q Sbjct: 119 GHICLNLLGEDWTPACSIESVLLSIQ 144 >UniRef50_A0BWT5 Cluster: Chromosome undetermined scaffold_133, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_133, whole genome shotgun sequence - Paramecium tetraurelia Length = 73 Score = 35.1 bits (77), Expect = 0.31 Identities = 19/53 (35%), Positives = 30/53 (56%), Gaps = 2/53 (3%) Frame = +3 Query: 135 LNKEAADELQSNRRL--FEQHVQRAMRGGYVGTSYFERCLK*NLHTCKKC*QP 287 +N A D Q+N +L ++H+Q+ + G V T C++ NL+ C KC QP Sbjct: 2 INWAANDMCQNNHKLQWVKKHIQKCAQCGPVDTMCRYGCVQCNLYYCVKCRQP 54 >UniRef50_Q7SGR9 Cluster: Ubiquitin carrier protein; n=11; Pezizomycotina|Rep: Ubiquitin carrier protein - Neurospora crassa Length = 212 Score = 35.1 bits (77), Expect = 0.31 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +3 Query: 15 DLEGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPN 122 D G +CL+IL++ W +++ LQ L EPN Sbjct: 176 DFSGRICLDILKDKWTAAYNTQTVLLSLQSLLGEPN 211 >UniRef50_P42743 Cluster: Ubiquitin-conjugating enzyme E2-18 kDa; n=19; Spermatophyta|Rep: Ubiquitin-conjugating enzyme E2-18 kDa - Arabidopsis thaliana (Mouse-ear cress) Length = 161 Score = 35.1 bits (77), Expect = 0.31 Identities = 15/42 (35%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIVYG-LQYLFLEPNPEDPLNKE 146 G++CL+IL + W P +TVNS+ L L P + P + + Sbjct: 96 GHICLDILYDSWSPAMTVNSVCISILSMLSSSPAKQRPADND 137 >UniRef50_Q8ILW5 Cluster: Ubiquitin conjugating enzyme, putative; n=7; Plasmodium|Rep: Ubiquitin conjugating enzyme, putative - Plasmodium falciparum (isolate 3D7) Length = 299 Score = 34.7 bits (76), Expect = 0.41 Identities = 13/21 (61%), Positives = 18/21 (85%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSI 86 G++CL+IL + W PVL+VNSI Sbjct: 235 GHICLSILYDHWSPVLSVNSI 255 >UniRef50_Q7QQ94 Cluster: Ubiquitin carrier protein; n=1; Giardia lamblia ATCC 50803|Rep: Ubiquitin carrier protein - Giardia lamblia ATCC 50803 Length = 164 Score = 34.7 bits (76), Expect = 0.41 Identities = 17/53 (32%), Positives = 29/53 (54%) Frame = +3 Query: 51 EDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHVQRAMR 209 E W PV TV+SI+ + L +PN + P N +AA + ++++ V +R Sbjct: 107 ERWLPVHTVSSIILSVISLLSDPNCKSPANVDAAKLYTDDYPMYKKRVLTCVR 159 >UniRef50_Q28XJ5 Cluster: GA20189-PA; n=1; Drosophila pseudoobscura|Rep: GA20189-PA - Drosophila pseudoobscura (Fruit fly) Length = 240 Score = 34.7 bits (76), Expect = 0.41 Identities = 12/21 (57%), Positives = 17/21 (80%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSI 86 G++CL+IL EDW P L+V S+ Sbjct: 130 GHICLSILTEDWSPALSVQSV 150 >UniRef50_Q20617 Cluster: Putative uncharacterized protein ubc-24; n=2; Caenorhabditis|Rep: Putative uncharacterized protein ubc-24 - Caenorhabditis elegans Length = 160 Score = 34.7 bits (76), Expect = 0.41 Identities = 15/44 (34%), Positives = 26/44 (59%) Frame = +3 Query: 42 ILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNR 173 +L+E+WKP T+ ++ L L EP+ P+N +AA + N+ Sbjct: 102 LLQENWKPETTMEDVLLNLIVLLNEPDLSRPVNIDAAHDYIHNK 145 >UniRef50_Q4P8X0 Cluster: Putative uncharacterized protein; n=1; Ustilago maydis|Rep: Putative uncharacterized protein - Ustilago maydis (Smut fungus) Length = 152 Score = 34.7 bits (76), Expect = 0.41 Identities = 12/26 (46%), Positives = 20/26 (76%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIVYGLQ 101 G++C +IL +W PVLT++S++ LQ Sbjct: 89 GHICASILGNEWSPVLTISSVLLTLQ 114 >UniRef50_Q96B02 Cluster: Probable ubiquitin-conjugating enzyme E2 W; n=50; Eukaryota|Rep: Probable ubiquitin-conjugating enzyme E2 W - Homo sapiens (Human) Length = 151 Score = 34.7 bits (76), Expect = 0.41 Identities = 12/21 (57%), Positives = 17/21 (80%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSI 86 G++CL+IL EDW P L+V S+ Sbjct: 88 GHICLSILTEDWSPALSVQSV 108 >UniRef50_P27949 Cluster: Ubiquitin-conjugating enzyme E2-21 kDa; n=2; African swine fever virus|Rep: Ubiquitin-conjugating enzyme E2-21 kDa - African swine fever virus (strain BA71V) (ASFV) Length = 215 Score = 34.7 bits (76), Expect = 0.41 Identities = 17/52 (32%), Positives = 28/52 (53%), Gaps = 8/52 (15%) Frame = +3 Query: 21 EGNVCLNILRED--------WKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAA 152 +G +C++IL D W P +++I+ + L EPNP+ P N +AA Sbjct: 81 DGRLCISILHGDNAEEQGMTWSPAQKIDTILLSVISLLNEPNPDSPANVDAA 132 >UniRef50_UPI0000E487EE Cluster: PREDICTED: similar to ubiquitin conjugating enzyme, partial; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to ubiquitin conjugating enzyme, partial - Strongylocentrotus purpuratus Length = 162 Score = 34.3 bits (75), Expect = 0.55 Identities = 20/59 (33%), Positives = 30/59 (50%), Gaps = 13/59 (22%) Frame = +3 Query: 15 DLEGNVCLNILRED-------------WKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAA 152 D EG+VC++IL E W P+ TV +I+ + + +PN E P N +AA Sbjct: 34 DKEGDVCISILHEPGEDKWGYERPSERWLPIHTVETILISVISMLADPNDESPANVDAA 92 >UniRef50_Q9N2W9 Cluster: Ubiquitin carrier protein; n=1; Caenorhabditis elegans|Rep: Ubiquitin carrier protein - Caenorhabditis elegans Length = 221 Score = 34.3 bits (75), Expect = 0.55 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = +3 Query: 15 DLEGNVCLNILREDWKPVLTVNSIVYG-LQYLFLEPNPEDPLNKEAA 152 + G VCL+++ + W + + +I L L PN DPLN EAA Sbjct: 82 EASGTVCLDVINQAWTALYDLTNIFDTFLPQLLTYPNAADPLNGEAA 128 >UniRef50_Q6BZP7 Cluster: Similarity; n=1; Yarrowia lipolytica|Rep: Similarity - Yarrowia lipolytica (Candida lipolytica) Length = 178 Score = 34.3 bits (75), Expect = 0.55 Identities = 16/36 (44%), Positives = 23/36 (63%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPED 131 G++CL+IL ++W PV TV S+ LQ + L N D Sbjct: 115 GHICLDILGDEWTPVQTVASVCISLQSM-LGSNDRD 149 >UniRef50_A7Q2F7 Cluster: Chromosome chr1 scaffold_46, whole genome shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome chr1 scaffold_46, whole genome shotgun sequence - Vitis vinifera (Grape) Length = 94 Score = 33.9 bits (74), Expect = 0.72 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = +3 Query: 45 LREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAA 152 L+E W P LT+ ++ + L ++ NP DPL E A Sbjct: 8 LKERWCPALTIIKVLLSICSLLMDSNPNDPLVPEIA 43 >UniRef50_Q5VVX9 Cluster: Ubiquitin-conjugating enzyme E2 U; n=11; Eutheria|Rep: Ubiquitin-conjugating enzyme E2 U - Homo sapiens (Human) Length = 321 Score = 33.9 bits (74), Expect = 0.72 Identities = 19/55 (34%), Positives = 29/55 (52%), Gaps = 2/55 (3%) Frame = +3 Query: 24 GNVCLNILR--EDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLF 182 G C++ L E W T++SI+ LQ + P E+P+N EAA L + L+ Sbjct: 86 GQPCIDFLDNPEKWNTNYTLSSILLALQVMLSNPVLENPVNLEAARILVKDESLY 140 >UniRef50_UPI0000F2BBBB Cluster: PREDICTED: similar to ubiquitin-conjugating enzyme E2U (putative),; n=1; Monodelphis domestica|Rep: PREDICTED: similar to ubiquitin-conjugating enzyme E2U (putative), - Monodelphis domestica Length = 313 Score = 33.5 bits (73), Expect = 0.96 Identities = 16/51 (31%), Positives = 27/51 (52%) Frame = +3 Query: 57 WKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHVQRAMR 209 W T+ SI+ +Q + P DP+N EAA + N+ LF+ ++M+ Sbjct: 239 WDRNHTLKSILLSIQEMLSYPTLHDPINLEAAQMIIDNKILFKDLALKSMK 289 >UniRef50_Q23GA4 Cluster: Ubiquitin-conjugating enzyme family protein; n=1; Tetrahymena thermophila SB210|Rep: Ubiquitin-conjugating enzyme family protein - Tetrahymena thermophila SB210 Length = 723 Score = 33.5 bits (73), Expect = 0.96 Identities = 16/49 (32%), Positives = 29/49 (59%), Gaps = 4/49 (8%) Frame = +3 Query: 54 DWKPVLTVNSIVYGLQYLFLEPN----PEDPLNKEAADELQSNRRLFEQ 188 +WKP LT+ I+ L++ F+EP+ P + N + A+ Q N++ F + Sbjct: 286 EWKPTLTLYFIILQLKFAFIEPDLTFVPNNIENVQCAELFQCNQQEFRR 334 >UniRef50_A0BMS1 Cluster: Chromosome undetermined scaffold_117, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_117, whole genome shotgun sequence - Paramecium tetraurelia Length = 1189 Score = 33.5 bits (73), Expect = 0.96 Identities = 16/55 (29%), Positives = 28/55 (50%) Frame = +3 Query: 21 EGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFE 185 +G +C +IL ++ TV I + L + P P+DPL+ A E N + ++ Sbjct: 1072 QGRICHSILDRNYTLDTTVLQIFQAIFGLLMTPEPDDPLDTTIASEYLENLQQYQ 1126 >UniRef50_A0A5E9 Cluster: Ubiquitin-conjugating enzyme,; n=1; Toxoplasma gondii RH|Rep: Ubiquitin-conjugating enzyme, - Toxoplasma gondii RH Length = 115 Score = 33.5 bits (73), Expect = 0.96 Identities = 11/25 (44%), Positives = 19/25 (76%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIVYGL 98 G+VCLN+L DW+P L++++I + Sbjct: 53 GDVCLNLLGSDWRPSLSISAIAVAI 77 >UniRef50_A5DNI5 Cluster: Putative uncharacterized protein; n=1; Pichia guilliermondii|Rep: Putative uncharacterized protein - Pichia guilliermondii (Yeast) (Candida guilliermondii) Length = 155 Score = 33.5 bits (73), Expect = 0.96 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIVYGLQYLFL 113 G++CLN+L EDW P + SI+ + + + Sbjct: 92 GHICLNLLGEDWTPACLIESILLSIHSMLV 121 >UniRef50_P29340 Cluster: Ubiquitin-conjugating enzyme E2-21 kDa; n=3; Saccharomycetales|Rep: Ubiquitin-conjugating enzyme E2-21 kDa - Saccharomyces cerevisiae (Baker's yeast) Length = 183 Score = 33.5 bits (73), Expect = 0.96 Identities = 16/40 (40%), Positives = 24/40 (60%), Gaps = 1/40 (2%) Frame = +3 Query: 24 GNVCLNILR-EDWKPVLTVNSIVYGLQYLFLEPNPEDPLN 140 G +CLNIL+ E+W PV + V+ + L EP + PL+ Sbjct: 112 GEICLNILKPEEWTPVWDLLHCVHAVWRLLREPVCDSPLD 151 >UniRef50_UPI00006064E0 Cluster: PREDICTED: similar to ubiquitin-conjugating enzyme E2D 4 (putative); n=1; Mus musculus|Rep: PREDICTED: similar to ubiquitin-conjugating enzyme E2D 4 (putative) - Mus musculus Length = 85 Score = 33.1 bits (72), Expect = 1.3 Identities = 14/31 (45%), Positives = 19/31 (61%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIVYGLQYLFLE 116 G++CL+ILR W P LTV+ + L LE Sbjct: 45 GSICLDILRSQWSPALTVSKGLLCLALAILE 75 >UniRef50_A2QG50 Cluster: Ubiquitin carrier protein; n=1; Aspergillus niger|Rep: Ubiquitin carrier protein - Aspergillus niger Length = 185 Score = 33.1 bits (72), Expect = 1.3 Identities = 11/32 (34%), Positives = 21/32 (65%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIVYGLQYLFLEP 119 G VCLNIL+++W L+V +++ + + +P Sbjct: 113 GEVCLNILQDEWSQALSVRTVLLSISAMLGDP 144 >UniRef50_Q9P6I1 Cluster: Ubiquitin-conjugating enzyme E2 16; n=1; Schizosaccharomyces pombe|Rep: Ubiquitin-conjugating enzyme E2 16 - Schizosaccharomyces pombe (Fission yeast) Length = 160 Score = 33.1 bits (72), Expect = 1.3 Identities = 15/48 (31%), Positives = 25/48 (52%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQS 167 G VC++IL+ W P ++ S + L + PLN +AA L++ Sbjct: 87 GEVCMDILKTHWSPAWSLQSACLAIISLLSNYDASSPLNVDAAKLLRT 134 >UniRef50_Q5YES5 Cluster: Ubiquitin conjugating enzyme E2 2; n=1; Bigelowiella natans|Rep: Ubiquitin conjugating enzyme E2 2 - Bigelowiella natans (Pedinomonas minutissima) (Chlorarachnion sp.(strain CCMP 621)) Length = 154 Score = 32.7 bits (71), Expect = 1.7 Identities = 14/57 (24%), Positives = 27/57 (47%) Frame = +3 Query: 15 DLEGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFE 185 D +G +C L++ W + S++ + L P+ D +N E A +Q + F+ Sbjct: 86 DSKGQICFQGLKDTWSSSMNAKSVIQFIIDLINNPDCGDAINSEVAKCMQEDMEKFK 142 >UniRef50_Q23K87 Cluster: Putative uncharacterized protein; n=1; Tetrahymena thermophila SB210|Rep: Putative uncharacterized protein - Tetrahymena thermophila SB210 Length = 232 Score = 32.7 bits (71), Expect = 1.7 Identities = 18/59 (30%), Positives = 34/59 (57%) Frame = +1 Query: 91 TVSSIYSWNQTLKIPSTRKQLTSSKATGDFSNNTFRELCEAATSAHLISNDASNETCTR 267 + +S + N+ IPS+ K TSSK S NT + +++++ ++N AS++T T+ Sbjct: 163 STASSSALNKNSTIPSSTKSTTSSKTIS--SGNTIQNKQSSSSTSKTLTNTASSKTLTK 219 >UniRef50_Q0JI74 Cluster: Ubiquitin carrier protein; n=2; Oryza sativa (japonica cultivar-group)|Rep: Ubiquitin carrier protein - Oryza sativa subsp. japonica (Rice) Length = 368 Score = 32.3 bits (70), Expect = 2.2 Identities = 10/19 (52%), Positives = 16/19 (84%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVN 80 G++CL+IL+E W P LT++ Sbjct: 183 GSICLDILKEQWSPALTIS 201 >UniRef50_Q54J27 Cluster: Ubiquitin carrier protein; n=6; Eukaryota|Rep: Ubiquitin carrier protein - Dictyostelium discoideum AX4 Length = 517 Score = 32.3 bits (70), Expect = 2.2 Identities = 15/53 (28%), Positives = 30/53 (56%) Frame = +3 Query: 51 EDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHVQRAMR 209 E W P +V +I+ L + +PN P N +A+ E ++++ EQ+ +R ++ Sbjct: 127 ERWLPTQSVTTIILSLMSILSDPNCSSPANVDASVEWRTDK---EQYKKRCLK 176 >UniRef50_UPI000150A88B Cluster: Ubiquitin-conjugating enzyme family protein; n=1; Tetrahymena thermophila SB210|Rep: Ubiquitin-conjugating enzyme family protein - Tetrahymena thermophila SB210 Length = 486 Score = 31.9 bits (69), Expect = 2.9 Identities = 15/44 (34%), Positives = 26/44 (59%), Gaps = 1/44 (2%) Frame = +3 Query: 21 EGNVCLNILREDWK-PVLTVNSIVYGLQYLFLEPNPEDPLNKEA 149 +G +C+N L++DW + +I ++ L + P PE LN+EA Sbjct: 95 KGEICVNTLKKDWNHQSWSFYNIFEVIKCLLIIPFPESALNEEA 138 >UniRef50_UPI000050708E Cluster: PREDICTED: similar to ubiquitin-conjugating enzyme E2G 1 (UBC7 homolog, C. elegans); n=1; Rattus norvegicus|Rep: PREDICTED: similar to ubiquitin-conjugating enzyme E2G 1 (UBC7 homolog, C. elegans) - Rattus norvegicus Length = 114 Score = 31.9 bits (69), Expect = 2.9 Identities = 15/49 (30%), Positives = 27/49 (55%), Gaps = 1/49 (2%) Frame = +3 Query: 51 EDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRL-FEQHV 194 E W PV TV +++ + + +PN + P N +A E + +R F++ V Sbjct: 63 ECWLPVYTVETMMIIVSSMLADPNGDSPANVDAVTEWREDRNAEFQRRV 111 >UniRef50_A0CCE4 Cluster: Chromosome undetermined scaffold_167, whole genome shotgun sequence; n=2; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_167, whole genome shotgun sequence - Paramecium tetraurelia Length = 175 Score = 31.9 bits (69), Expect = 2.9 Identities = 19/67 (28%), Positives = 31/67 (46%), Gaps = 6/67 (8%) Frame = +3 Query: 24 GNVCLNILRED--WKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAA----DELQSNRRLFE 185 G C++IL + + P T I+ L+ PNP+ P N E A +L + + Sbjct: 98 GKTCIDILNDKIGYSPAKTCVEILKALEDFLYRPNPKSPTNAELAKIFEQDLPKYELMIK 157 Query: 186 QHVQRAM 206 + VQ+ M Sbjct: 158 EFVQKYM 164 >UniRef50_A6SB88 Cluster: Predicted protein; n=1; Botryotinia fuckeliana B05.10|Rep: Predicted protein - Botryotinia fuckeliana B05.10 Length = 391 Score = 31.9 bits (69), Expect = 2.9 Identities = 13/45 (28%), Positives = 26/45 (57%) Frame = +1 Query: 91 TVSSIYSWNQTLKIPSTRKQLTSSKATGDFSNNTFRELCEAATSA 225 + +++ WN K+ ++ L ++ GDF+++ RE AAT+A Sbjct: 168 SATTLQEWNTLSKLKNSPYALNGKRSYGDFNSDLAREKANAATTA 212 >UniRef50_UPI000066142F Cluster: Homolog of Brachydanio rerio "Ubiquitin-conjugating enzyme E2D 2.; n=1; Takifugu rubripes|Rep: Homolog of Brachydanio rerio "Ubiquitin-conjugating enzyme E2D 2. - Takifugu rubripes Length = 156 Score = 31.5 bits (68), Expect = 3.9 Identities = 10/19 (52%), Positives = 15/19 (78%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVN 80 G++CL+ILR W P LT++ Sbjct: 53 GSICLDILRSQWSPALTIS 71 >UniRef50_Q0IF72 Cluster: Ubiquitin-conjugating enzyme morgue; n=2; Culicidae|Rep: Ubiquitin-conjugating enzyme morgue - Aedes aegypti (Yellowfever mosquito) Length = 392 Score = 31.5 bits (68), Expect = 3.9 Identities = 14/59 (23%), Positives = 32/59 (54%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHVQR 200 G+V ++I++ +W LT++ ++ +Q L +P + + E +++R FE +R Sbjct: 316 GDVGIDIIQHNWSLALTISKLLLSVQSLLTDPFTQICMEPELGRMYENDRPKFEALARR 374 >UniRef50_Q5PPQ4 Cluster: CDNA sequence BC043301; n=6; Murinae|Rep: CDNA sequence BC043301 - Mus musculus (Mouse) Length = 887 Score = 31.1 bits (67), Expect = 5.1 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +1 Query: 163 KATGDFSNNTFRELCEAATSAHLISNDASNETCT 264 +A G+ + ++L TSAHL+ D+SN CT Sbjct: 205 EANGEEQGSVTKQLNGLVTSAHLLPQDSSNANCT 238 >UniRef50_Q4Q5I6 Cluster: Ubiquitin carrier protein; n=5; Trypanosomatidae|Rep: Ubiquitin carrier protein - Leishmania major Length = 271 Score = 31.1 bits (67), Expect = 5.1 Identities = 14/46 (30%), Positives = 26/46 (56%), Gaps = 3/46 (6%) Frame = +3 Query: 57 WKPVLTVNSIVYGLQYLFLEPNPED---PLNKEAADELQSNRRLFE 185 W PV T+ S++ + L+ +P+P D P N +A + ++ R F+ Sbjct: 108 WTPVQTIRSVLLSIVSLWSDPDPSDAGAPANVDALVQYRNRRAEFD 153 >UniRef50_O62471 Cluster: Putative uncharacterized protein qui-1; n=2; Caenorhabditis|Rep: Putative uncharacterized protein qui-1 - Caenorhabditis elegans Length = 1592 Score = 31.1 bits (67), Expect = 5.1 Identities = 13/35 (37%), Positives = 19/35 (54%) Frame = +3 Query: 30 VCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDP 134 VC + +DWKP TV ++ QY+ + N DP Sbjct: 856 VCRSFTLKDWKPGNTVLTLSANHQYILISGNQSDP 890 >UniRef50_UPI00015B43E7 Cluster: PREDICTED: similar to ubiquitin-conjugating enzyme morgue; n=1; Nasonia vitripennis|Rep: PREDICTED: similar to ubiquitin-conjugating enzyme morgue - Nasonia vitripennis Length = 522 Score = 30.7 bits (66), Expect = 6.7 Identities = 16/65 (24%), Positives = 33/65 (50%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHVQRA 203 G+V ++ + +W LT++ ++ +Q L +P + + E + ++R FE+ V RA Sbjct: 450 GDVGIDSIHHNWSLALTISKVLISVQSLLTDPYCQVCMEPELGEMYMNDRARFEE-VARA 508 Query: 204 MRGGY 218 Y Sbjct: 509 WTWKY 513 >UniRef50_Q5UQ40 Cluster: Putative uncharacterized protein; n=1; Acanthamoeba polyphaga mimivirus|Rep: Putative uncharacterized protein - Mimivirus Length = 1297 Score = 30.7 bits (66), Expect = 6.7 Identities = 16/57 (28%), Positives = 28/57 (49%) Frame = +3 Query: 24 GNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHV 194 G VC +IL ++ P + ++ I+ + L L P+ DPL+ A L+E + Sbjct: 1214 GRVCHSILDRNYTPNVKISLILQCIYGLLLNPDVNDPLDTNLAMIYYDANGLYEAQI 1270 >UniRef50_Q2SHS3 Cluster: Secreted trypsin-like serine protease; n=3; cellular organisms|Rep: Secreted trypsin-like serine protease - Hahella chejuensis (strain KCTC 2396) Length = 693 Score = 30.7 bits (66), Expect = 6.7 Identities = 13/39 (33%), Positives = 20/39 (51%) Frame = +3 Query: 120 NPEDPLNKEAADELQSNRRLFEQHVQRAMRGGYVGTSYF 236 +P DP N + + +S + L E H Q G G++YF Sbjct: 543 DPTDPTNPDDCELTESQKALLEAHNQARSEGRNCGSAYF 581 >UniRef50_Q4C9G5 Cluster: PemK-like protein; n=1; Crocosphaera watsonii WH 8501|Rep: PemK-like protein - Crocosphaera watsonii Length = 120 Score = 30.7 bits (66), Expect = 6.7 Identities = 19/38 (50%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Frame = +3 Query: 54 DWKPVLTVNSIVYGLQYLFLEPNPEDPLNK-EAADELQ 164 DWKP + N L +L L PNPE+ L K AAD LQ Sbjct: 50 DWKPAFSNN-----LWHLRLTPNPENGLRKLSAADALQ 82 >UniRef50_A6V9G8 Cluster: Putative uncharacterized protein; n=1; Pseudomonas aeruginosa PA7|Rep: Putative uncharacterized protein - Pseudomonas aeruginosa PA7 Length = 183 Score = 30.7 bits (66), Expect = 6.7 Identities = 19/45 (42%), Positives = 24/45 (53%) Frame = +3 Query: 48 REDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLF 182 RE PV IV L Y L E P +EAA++L+ NRR+F Sbjct: 77 RETAGPVFFDRGIVDVLGYARLSRLDEPPALREAANDLRYNRRVF 121 >UniRef50_Q18288 Cluster: Ubiquitin conjugating enzyme protein 23; n=1; Caenorhabditis elegans|Rep: Ubiquitin conjugating enzyme protein 23 - Caenorhabditis elegans Length = 546 Score = 30.7 bits (66), Expect = 6.7 Identities = 13/57 (22%), Positives = 31/57 (54%), Gaps = 1/57 (1%) Frame = +3 Query: 21 EGNVCLNILRED-WKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQ 188 +G +CL+ + W +T+ ++ +Q N ++P++ E ++ +NR +FE+ Sbjct: 430 DGTICLHDVDNGVWPVSMTIYKVLIVIQSWMSNFNEKEPIDVEILEQATNNREVFEK 486 >UniRef50_A0C867 Cluster: Ubiquitin carrier protein; n=4; Oligohymenophorea|Rep: Ubiquitin carrier protein - Paramecium tetraurelia Length = 233 Score = 30.7 bits (66), Expect = 6.7 Identities = 11/48 (22%), Positives = 25/48 (52%) Frame = +3 Query: 57 WKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHVQR 200 W+P+LT ++ + + EPN P N +A + + +++ V++ Sbjct: 177 WRPILTPEDVLISIVSMLSEPNINSPANVDAGIQFRDKPDEYKKKVRK 224 >UniRef50_P60604 Cluster: Ubiquitin-conjugating enzyme E2 G2; n=80; Eukaryota|Rep: Ubiquitin-conjugating enzyme E2 G2 - Homo sapiens (Human) Length = 165 Score = 30.7 bits (66), Expect = 6.7 Identities = 14/44 (31%), Positives = 22/44 (50%) Frame = +3 Query: 51 EDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLF 182 E W PV +V I+ + + EPN E N +A+ + +R F Sbjct: 108 ERWSPVQSVEKILLSVVSMLAEPNDESGANVDASKMWRDDREQF 151 >UniRef50_Q01631 Cluster: Adenylate cyclase; n=7; Sordariomycetes|Rep: Adenylate cyclase - Neurospora crassa Length = 2300 Score = 30.7 bits (66), Expect = 6.7 Identities = 18/54 (33%), Positives = 26/54 (48%) Frame = +2 Query: 11 ERPRRQRVPEYTQGRLETCSHS*LHSVRSPVFILGTKP*RSPQQGSS*RAPKQQ 172 E + Q P +TQ R + S + L S P L ++ +SP Q S + P QQ Sbjct: 91 ESSQSQSQPSHTQTRSHSLSQATLQSCSQPQLSLNSQQSQSPSQYHSQQTPTQQ 144 >UniRef50_UPI00015B5F18 Cluster: PREDICTED: similar to retinaldehyde binding protein; n=1; Nasonia vitripennis|Rep: PREDICTED: similar to retinaldehyde binding protein - Nasonia vitripennis Length = 404 Score = 30.3 bits (65), Expect = 8.9 Identities = 15/46 (32%), Positives = 23/46 (50%) Frame = +3 Query: 12 RDLEGNVCLNILREDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEA 149 RD +G L IL W P+ +V +L LE +DP N+++ Sbjct: 120 RDRKGRCVLIILASQWDPIAIPALVVQRAIFLVLETLIQDPRNQQS 165 >UniRef50_UPI0000498417 Cluster: ubiquitin-conjugating enzyme; n=1; Entamoeba histolytica HM-1:IMSS|Rep: ubiquitin-conjugating enzyme - Entamoeba histolytica HM-1:IMSS Length = 219 Score = 30.3 bits (65), Expect = 8.9 Identities = 12/42 (28%), Positives = 23/42 (54%) Frame = +3 Query: 51 EDWKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRR 176 E W P +V+SI+ +Q + +PN P N +A + + + + Sbjct: 106 ERWLPTQSVSSILLSVQSMLCDPNMYSPANTDAMVQCRDHNK 147 >UniRef50_A2ADC1 Cluster: Novel protein containing an Ubiquitin-conjugating enzyme domain; n=4; Eutheria|Rep: Novel protein containing an Ubiquitin-conjugating enzyme domain - Mus musculus (Mouse) Length = 352 Score = 30.3 bits (65), Expect = 8.9 Identities = 17/50 (34%), Positives = 25/50 (50%) Frame = +3 Query: 57 WKPVLTVNSIVYGLQYLFLEPNPEDPLNKEAADELQSNRRLFEQHVQRAM 206 W TV SI+ LQ L P ++P+N EAA L N ++ +Q + Sbjct: 99 WNTNYTVLSILLDLQMLLSYPVLKNPVNLEAAQLLIRNASTYKMVIQELL 148 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 298,720,095 Number of Sequences: 1657284 Number of extensions: 5252558 Number of successful extensions: 15548 Number of sequences better than 10.0: 254 Number of HSP's better than 10.0 without gapping: 15207 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15511 length of database: 575,637,011 effective HSP length: 86 effective length of database: 433,110,587 effective search space used: 10394654088 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -