BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0428 (475 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC577.08c |txl1|trx3|thioredoxin-like I protein Txl1|Schizosac... 29 0.36 SPCC1620.10 |cwf26||complexed with Cdc5 protein Cwf26 |Schizosac... 25 5.9 SPAC630.04c |||sequence orphan|Schizosaccharomyces pombe|chr 1||... 25 7.8 >SPBC577.08c |txl1|trx3|thioredoxin-like I protein Txl1|Schizosaccharomyces pombe|chr 2|||Manual Length = 290 Score = 29.1 bits (62), Expect = 0.36 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +3 Query: 288 LYDSDDQYSFRSLYFGFFHRQNSMICFLYEGL 383 +Y+ DDQ + L F F R NS++ F+Y + Sbjct: 228 VYEQDDQPTIIPLRFVKFQRVNSLVIFIYSNV 259 >SPCC1620.10 |cwf26||complexed with Cdc5 protein Cwf26 |Schizosaccharomyces pombe|chr 3|||Manual Length = 305 Score = 25.0 bits (52), Expect = 5.9 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -1 Query: 391 YTNSPSYKKQIMEFXRWKKP 332 Y + P Y K++ E RW P Sbjct: 219 YEDDPEYNKELKERSRWNDP 238 >SPAC630.04c |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 166 Score = 24.6 bits (51), Expect = 7.8 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -3 Query: 470 QSDTPHSLHNRPRSMGTXSRQY 405 Q T HS+H R RS S+Q+ Sbjct: 72 QQRTQHSIHRRERSSSGASQQF 93 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,847,901 Number of Sequences: 5004 Number of extensions: 33708 Number of successful extensions: 73 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 67 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 73 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 182448900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -