BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0428 (475 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL022272-1|CAA18354.1| 77|Caenorhabditis elegans Hypothetical ... 27 9.1 >AL022272-1|CAA18354.1| 77|Caenorhabditis elegans Hypothetical protein H12C20.2b protein. Length = 77 Score = 26.6 bits (56), Expect = 9.1 Identities = 15/44 (34%), Positives = 21/44 (47%), Gaps = 2/44 (4%) Frame = -2 Query: 297 YHRGLCCLV*TK*LKP*MIKLFIQRLDLCFLVTSN--VKHSMNR 172 +HR C L+ + L P ++KL+ C LV N V NR Sbjct: 22 FHRRQCSLLFSSVLTPELLKLYFNSTGCCQLVKCNSAVNRQFNR 65 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,040,270 Number of Sequences: 27780 Number of extensions: 181629 Number of successful extensions: 325 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 323 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 325 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 860942358 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -