BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0424 (480 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ555537-1|CAD88245.1| 210|Apis mellifera putative chemosensory... 22 3.0 DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. 21 5.2 >AJ555537-1|CAD88245.1| 210|Apis mellifera putative chemosensory receptor 2 protein. Length = 210 Score = 22.2 bits (45), Expect = 3.0 Identities = 6/23 (26%), Positives = 15/23 (65%) Frame = -3 Query: 184 IYKRYLVFEPAYILKVSLSCYWF 116 I+ L+ E + +++ + SC+W+ Sbjct: 175 IFGNRLIEESSSVMEAAYSCHWY 197 >DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. Length = 495 Score = 21.4 bits (43), Expect = 5.2 Identities = 9/31 (29%), Positives = 16/31 (51%) Frame = +1 Query: 37 LFIPKASPISPKTTDFYMYFYLIKYIKTNNN 129 +F+ + +PK T Y + I + TN+N Sbjct: 152 MFVARHLAETPKNTSAVRYTHYIGTLATNDN 182 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 126,845 Number of Sequences: 438 Number of extensions: 2328 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 13051674 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -