BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= br--0418 (464 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ438610-3|CAD27475.1| 190|Anopheles gambiae putative RHO small... 46 5e-07 EF127647-1|ABL74413.1| 213|Anopheles gambiae Rab5 protein. 42 1e-05 AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein ... 30 0.046 AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase pr... 25 1.7 M93689-1|AAA29368.1| 442|Anopheles gambiae protein ( Anopheles ... 23 4.0 AY324308-1|AAQ89693.1| 134|Anopheles gambiae insulin-like pepti... 23 4.0 AF515734-1|AAO14865.1| 1325|Anopheles gambiae xanthine dehydroge... 23 5.3 Z69980-1|CAA93820.1| 134|Anopheles gambiae GTP-binding protein ... 23 6.9 >AJ438610-3|CAD27475.1| 190|Anopheles gambiae putative RHO small GTPase protein. Length = 190 Score = 46.4 bits (105), Expect = 5e-07 Identities = 24/70 (34%), Positives = 37/70 (52%) Frame = +3 Query: 255 SALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGE 434 + + I + F EY PT D+Y +V+DG L + DTAGQE+Y +R + Sbjct: 20 TCMLISYTTDSFPGEYVPTSFDNYSAPMVVDGVQVSLGLWDTAGQEDYDRLRPLSYPQTD 79 Query: 435 GFLLVFAVNS 464 FL+ ++V S Sbjct: 80 VFLICYSVAS 89 >EF127647-1|ABL74413.1| 213|Anopheles gambiae Rab5 protein. Length = 213 Score = 41.9 bits (94), Expect = 1e-05 Identities = 25/90 (27%), Positives = 46/90 (51%), Gaps = 1/90 (1%) Frame = +3 Query: 198 ISQDDRVQIGGCGCGRRW*SALTIQLIQNHFVDEYDPTIEDSYRKQVV-IDGETCLLDIL 374 I Q V +G G+ S+L ++ ++ F + + TI ++ Q + ID T +I Sbjct: 22 ICQFKLVLLGESAVGK---SSLVLRFVKGQFHEYQESTIGAAFLTQTLCIDDTTVKFEIW 78 Query: 375 DTAGQEEYSAMRDQYMRTGEGFLLVFAVNS 464 DTAGQE Y ++ Y R + ++V+ + + Sbjct: 79 DTAGQERYHSLAPMYYRGAQAAIVVYDIQN 108 >AF002238-1|AAB97731.1| 327|Anopheles gambiae ribosomal protein L5 protein. Length = 327 Score = 29.9 bits (64), Expect = 0.046 Identities = 15/30 (50%), Positives = 16/30 (53%) Frame = -3 Query: 375 PGCRVNTSHRRSRLVYGTNPLSWDRIRPRS 286 P CR + RRSR T P SW R RP S Sbjct: 269 PSCRSPPARRRSR---STRPTSWPRSRPTS 295 >AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase protein. Length = 1253 Score = 24.6 bits (51), Expect = 1.7 Identities = 22/60 (36%), Positives = 28/60 (46%), Gaps = 4/60 (6%) Frame = +3 Query: 273 LIQNHFVDEYDPTIEDSYRKQVVID-GET---CLLDILDTAGQEEYSAMRDQYMRTGEGF 440 L++N + +Y T D R V D GE C L +L + EYSA D Y EGF Sbjct: 472 LMENSVMKKYT-TKSDQARHYVQYDQGEDRWLCTL-LLKQKFRVEYSAASDAYTHAPEGF 529 >M93689-1|AAA29368.1| 442|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 442 Score = 23.4 bits (48), Expect = 4.0 Identities = 15/64 (23%), Positives = 28/64 (43%) Frame = -2 Query: 385 PAVSRMSSKHVSPSITTCLRYESSIVGSYSSTK*FCISCIVNADYQRLPHPQPPICTRSS 206 P+VS+ S H S + ++ + + S+ + F S + AD Q+ + + S Sbjct: 151 PSVSQPSRTHTSTNASSLNATNTRTTKTASTRRTFTNSMELTADIQQAANDTNTVEASDS 210 Query: 205 CEIY 194 C Y Sbjct: 211 CNHY 214 >AY324308-1|AAQ89693.1| 134|Anopheles gambiae insulin-like peptide 2 precursor protein. Length = 134 Score = 23.4 bits (48), Expect = 4.0 Identities = 12/22 (54%), Positives = 14/22 (63%), Gaps = 1/22 (4%) Frame = -3 Query: 402 PNTLP-GQPCPGCRVNTSHRRS 340 P+TLP G P PG V+ RRS Sbjct: 90 PDTLPPGFPYPGAGVHRRSRRS 111 >AF515734-1|AAO14865.1| 1325|Anopheles gambiae xanthine dehydrogenase protein. Length = 1325 Score = 23.0 bits (47), Expect = 5.3 Identities = 14/31 (45%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = +3 Query: 228 GCGCGRRW*SALTIQLIQ-NHFVDEYDPTIE 317 G GCG+ L +L Q N FV YDP+ E Sbjct: 168 GNGCGQNGNGELDTELFQPNEFV-PYDPSQE 197 >Z69980-1|CAA93820.1| 134|Anopheles gambiae GTP-binding protein protein. Length = 134 Score = 22.6 bits (46), Expect = 6.9 Identities = 11/29 (37%), Positives = 17/29 (58%) Frame = +3 Query: 378 TAGQEEYSAMRDQYMRTGEGFLLVFAVNS 464 +AGQE+Y +R + FL+ F+V S Sbjct: 1 SAGQEDYDRLRPLSYPQTDVFLVCFSVVS 29 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 533,972 Number of Sequences: 2352 Number of extensions: 10670 Number of successful extensions: 23 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 40395045 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -